SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791818|ref|YP_003182424.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791818|ref|YP_003182424.1|
Domain Number 1 Region: 18-128
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 1.84e-24
Family Siroheme synthase N-terminal domain-like 0.0012
Further Details:      
 
Domain Number 2 Region: 130-224
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 1.07e-21
Family Siroheme synthase middle domains-like 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257791818|ref|YP_003182424.1|
Sequence length 235
Comment siroheme synthase [Eggerthella lenta DSM 2243]
Sequence
MVETVRERIPDGAEEGASYYPVFLDVRGRTALVVGGGAVAERKAAGLARAGACVRVVAPT
VTAGLEAQARDGLVDLRRRAFRENDVEGVFLVYAATDDAAVNEAVYAEAEARGVPANVVD
DPAHCSFIVPSVVRRGPLQLAVSTSGAAPVLAKRLRRELEGRFPEDWAVYVDLLAEVRAL
VRSRMAGGEAERAPVLEAACDLGVLERLRAGERLDAEAVYAEALRAARAGAGDGR
Download sequence
Identical sequences A0A096LKG3 C8WIZ4
479437.Elen_2072 gi|257791818|ref|YP_003182424.1| WP_015760941.1.14381 WP_015760941.1.87427 WP_015760941.1.89587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]