SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791879|ref|YP_003182485.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791879|ref|YP_003182485.1|
Domain Number 1 Region: 9-232
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 5.27e-63
Family G proteins 0.00000012
Further Details:      
 
Domain Number 2 Region: 308-400
Classification Level Classification E-value
Superfamily EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 1.15e-35
Family EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain 0.00000862
Further Details:      
 
Domain Number 3 Region: 212-307
Classification Level Classification E-value
Superfamily Translation proteins 1.69e-27
Family Elongation factors 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257791879|ref|YP_003182485.1|
Sequence length 400
Comment translation elongation factor Tu [Eggerthella lenta DSM 2243]
Sequence
MAKEKFERSKPHVNIGTIGHVDHGKTTLTAAISKTLSENDGSHGSARADFTAFENIDKAP
EERERGITISIAHIEYETDSRHYAHVDCPGHADYVKNMITGAAQMDGAILVIAATDGPMA
QTREHILLARQVGVPYIVVFLNKCDMVDDEELLELVEMEVRELLDSYEFPGDDTPIIRGS
ALKALEGDKEWQEKVWELMDAVDSYIPTPERMVDKPFLMAVEDTMTITGRGTVATGRVER
GTLHVNDPLEIVGIKETQNTVCTGIEMFRKLLDEAQAGDNIGCLLRGVKREEIVRGQVLC
KPGSVTPHTEFEGQVYILTKEEGGRHTPFFDGYRPQFYFRTTDVTGVAHLPEGTEMVMPG
DNVEIKGELIHPIAMEEGLRFAIREGGRTVGSGRVTKIIK
Download sequence
Identical sequences A0A096KH27 C8WJG7 F0HJF7 T4C230
gi|257791879|ref|YP_003182485.1| WP_009306296.1.14381 WP_009306296.1.74853 WP_009306296.1.87427 WP_009306296.1.89587 WP_009306296.1.95410 479437.Elen_2133

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]