SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257791906|ref|YP_003182512.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257791906|ref|YP_003182512.1|
Domain Number 1 Region: 6-63
Classification Level Classification E-value
Superfamily Ribosomal protein L30p/L7e 8.76e-20
Family Ribosomal protein L30p/L7e 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257791906|ref|YP_003182512.1|
Sequence length 63
Comment 50S ribosomal protein L30 [Eggerthella lenta DSM 2243]
Sequence
MADAKKTLRITQVKSSIGYKEDQGKTLRALGLGKINRSVEQVDNESVRGMIFKVKHLVKV
EEI
Download sequence
Identical sequences A0A096KHF0 C8WJJ4 F0HJC9 T4BD41
WP_009306338.1.14381 WP_009306338.1.74853 WP_009306338.1.87427 WP_009306338.1.89587 WP_009306338.1.95410 479437.Elen_2160 gi|257791906|ref|YP_003182512.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]