SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257792220|ref|YP_003182826.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257792220|ref|YP_003182826.1|
Domain Number 1 Region: 2-98
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 2.45e-20
Family DNA-binding N-terminal domain of transcription activators 0.0015
Further Details:      
 
Domain Number 2 Region: 117-268
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.0000000000000331
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257792220|ref|YP_003182826.1|
Sequence length 269
Comment MerR family transcriptional regulator [Eggerthella lenta DSM 2243]
Sequence
MFYIGEFSKMGKTTVKTLHHYDRIGLLKPAAVDGVTGYRLYTTQQLAELHRIQALRQAGL
SVDEVTAIVRGADPQPILVRRRGEIERELAARQDRLARIAFMLSDEGKGFPMGYQATIKD
IPSCIVFSKTMTVPDYSAYFEVIPAIGRAVKAANPDLKCATPEYCFIKYLDGEYKERDIT
MKYSEAVEDFGVEADGIVFEEVPAATVVSVMHRGSYADLPRAYAFAMEWVERNGYRLTDL
PRESYIDGVWSGIPESEWLTEIQVPVEKR
Download sequence
Identical sequences A0A096LKW1 C8WL58
WP_015761213.1.14381 WP_015761213.1.87427 WP_015761213.1.89587 479437.Elen_2481 gi|257792220|ref|YP_003182826.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]