SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257792280|ref|YP_003182886.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257792280|ref|YP_003182886.1|
Domain Number 1 Region: 2-299
Classification Level Classification E-value
Superfamily Aldolase 3.66e-82
Family HMGL-like 0.000000476
Further Details:      
 
Domain Number 2 Region: 296-444
Classification Level Classification E-value
Superfamily post-HMGL domain-like 3.92e-42
Family Conserved carboxylase domain 0.0000294
Further Details:      
 
Domain Number 3 Region: 540-617
Classification Level Classification E-value
Superfamily Single hybrid motif 1.1e-20
Family Biotinyl/lipoyl-carrier proteins and domains 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257792280|ref|YP_003182886.1|
Sequence length 629
Comment acetyl-CoA carboxylase, biotin carboxyl carrier protein [Eggerthella lenta DSM 2243]
Sequence
MPRLQIMDTTIRDGQQSLWATRMQIGDMLPILPKMDRVGYWAIEAWGGATFDTCMRFLDE
NPWERLRSIKAQTPNTPLSMLSRGQNLVGYKHYSRDICNHFIKAAKRNGVHVFRVFDALN
DIRNVVDNAEAIKECGGHFEGAISYTMSPVHTLDSFLDYGQKLKDLGADSICIKDMAGML
TPYRTERMVKAFNAEIGLPLHIHCHYVGGMAPANILKAAEAGAAIADTAHAPLAFGNSHP
AVEMIVAALQESRYDTGLDLDLLFEIAEYWEGVRKRGHYKRGVSSLTHMQVYSHQVPGGM
MSNLVSQLEIQNAADRLPEVMKEIPKVRAEVGYPPLVTPMSQIVGTQAVFNVLTGKRWSV
VSKEMKDYICGYYGKAPGRMDKDIVAKVVGNSEMLPPDVAPGSLVTTTYAQVEEEIGDLA
KSEEDVLMYALFPNEARTFLSKHRTSEKVDFLMEQESSHTKEDDYVDINQIRELVRVAEE
SGVGEIVVEEEGTRIAVRMPGTLSSEAAAAAAAAPVAAVAPAPAAAAPAAAADDVERPSD
WYAVTAPMVGTFYASPAPGEPPFVQVGDEVAANQTLCIVEAMKLMNEIAAEEMGTVREVC
LEDASPVEFGTVLFYVEPHGAPAPAPETA
Download sequence
Identical sequences C8WLN4
gi|257792280|ref|YP_003182886.1| WP_015761250.1.14381 479437.Elen_2542

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]