SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257792721|ref|YP_003183327.1| from Eggerthella lenta DSM 2243

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257792721|ref|YP_003183327.1|
Domain Number 1 Region: 4-291
Classification Level Classification E-value
Superfamily Acetamidase/Formamidase-like 3.27e-83
Family Acetamidase/Formamidase-like 0.00000243
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257792721|ref|YP_003183327.1|
Sequence length 298
Comment Acetamidase/Formamidase [Eggerthella lenta DSM 2243]
Sequence
MQELNDERVLFAFARDLEPALTVASGETVRIRTQDCFGNQVQTPEDELDEIDWDRINPAT
GPVFVEGAVPGGALKVTIENIELDPQTASCTGKDEGVCGDRFDAWSTHLCAIDGDKLVWN
DQLSIPLNPMIGVIGVAPAGDPVNCGTPGSHGGNMDNTAITTGATLYFPVAVEGALFGCG
DMHAAMGDGEISVSGAEVAGYATVTLTALPDLHLVDPLIENGTHLGIIASAESLDAAADR
AVHEMVDLLHDRTGVDEAELVMLLSLVADVQVCQMVDPQKTVRFMVPKYVLESLGFKL
Download sequence
Identical sequences A0A096KTI3 C8WNZ3 F0HMS9 T4BRE9
479437.Elen_2995 gi|257792721|ref|YP_003183327.1| WP_009305352.1.14381 WP_009305352.1.74853 WP_009305352.1.87427 WP_009305352.1.95410

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]