SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222096146|ref|YP_002530203.1| from Bacillus cereus Q1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|222096146|ref|YP_002530203.1|
Domain Number - Region: 19-44
Classification Level Classification E-value
Superfamily TrpR-like 0.0476
Family Chromosomal replication initiation factor DnaA C-terminal domain IV 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222096146|ref|YP_002530203.1|
Sequence length 60
Comment transposase (10) [Bacillus cereus Q1]
Sequence
MSYSHFTTFKCGQLEALHKLGHSTREIGAILKRHHSSIARELKRNVQKDGTYRSETAFYY
Download sequence
Identical sequences B9J1X8
361100.BCQ_2486 gi|222096146|ref|YP_002530203.1| WP_000122266.1.91615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]