SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222097027|ref|YP_002531084.1| from Bacillus cereus Q1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222097027|ref|YP_002531084.1|
Domain Number 1 Region: 255-788
Classification Level Classification E-value
Superfamily Formate dehydrogenase/DMSO reductase, domains 1-3 1.27e-193
Family Formate dehydrogenase/DMSO reductase, domains 1-3 0.00000000538
Further Details:      
 
Domain Number 2 Region: 5-128
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 3.87e-33
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.0024
Further Details:      
 
Domain Number 3 Region: 789-936
Classification Level Classification E-value
Superfamily ADC-like 4.75e-33
Family Formate dehydrogenase/DMSO reductase, C-terminal domain 0.0026
Further Details:      
 
Domain Number 4 Region: 136-218
Classification Level Classification E-value
Superfamily 4Fe-4S ferredoxins 9.42e-17
Family Ferredoxin domains from multidomain proteins 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|222097027|ref|YP_002531084.1|
Sequence length 979
Comment formate dehydrogenase subunit alpha [Bacillus cereus Q1]
Sequence
MNNNMVHITIDGKKYTAEPGSTILGVINENGIEHPQICYVPEVDPIQTCDTCIVEVDGKL
TRSCSTVVAEGMNIERNSTRAKEAQTEAMDRLLENHLLYCTVCDNNNGNCKLHNTAELME
IEHQKYPYEPKVDVSEVDMTHPFYRYDPNQCIACGQCVEVCQNLQVNETLSIDWEAERPR
VIWDEGVNINDSSCVSCGQCVTICPCNALMEKTMLGEAGFMTGLKPDILEPMVDLIKEVE
PGYSGIFAVSEVEAAMRDTRTKKTKTVCTFCGVGCSFEVWTKGRKILKVQPSSDAPVNAI
STCVKGKFGWDFVNSKERITKPLIRKNGTFVESTWEEALNVVASKLGSIKEEYGKDAIGF
ISSSKITNEDNYVIQKLARQVFETNNIDNCSRYCQSPATDGLFRTIGMGGDAGTIKDIAQ
SGLVIIVGCNPTEGHPVLATRIKRAHKLHGQKLIVADLRKTEMAERSDVFISPKQGTDQV
WLMAVTKYMIDQGWHDQRFIDENVNFFEDFKESLTAYTLEYAEEMTGISKETLIQMAEMI
RDADGTCILWGMGVTQNTGGSDTSAAISNLLLATGNYRRPGAGAYPLRGHNNVQGACDMG
TLPGWLPGYQHVTNDMERAKFEMAYGVKINSEPGLNNIEMLHAIDEGKMKAMYLVGEDMA
LVDSNANHVHEVLSSLDFFVVQDVFLSKTAQYADVVLPAAPSLEKEGTFTNTERRVQRLY
QVLPTLGDAKPDWWIVQEVANKLGANWSYSHPSEIFAEMASLSPLFSQANYEVLEGWNSF
HWGSFDGTNTPLLFQDGFNFPDKKARFAIADWVRPAEFPAEFDLHINNGRMLEHFHEGNM
TNKSTGIQTKVLGVFVEISPALAKERGVKTGSLVRLVSPFGALKLRALVTDRVKANELYL
PMNSTDNETAINFLTGPAVDTRTNTPAYKQTKVRMEVLEVDGENPMPKANPRNKKRHPQS
GIEVHRKWARPGYVHLTDK
Download sequence
Identical sequences B9ITV1
361100.BCQ_3367 gi|222097027|ref|YP_002531084.1| WP_001063655.1.50316

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]