SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222097901|ref|YP_002531958.1| from Bacillus cereus Q1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222097901|ref|YP_002531958.1|
Domain Number 1 Region: 2-183
Classification Level Classification E-value
Superfamily ITPase-like 6.21e-63
Family Maf-like 0.00000149
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|222097901|ref|YP_002531958.1|
Sequence length 191
Comment maf-like protein [Bacillus cereus Q1]
Sequence
MRKIILASGSPRRKELLELASVPFEIIVSEVEETIGAYSSPSDIVMSLALQKASAVAEYN
SDHIVLGADTIVTYESRILGKPSNEAEAKEMLQLLSGKTHEVYTGVAIIAKDKTVTFYER
TEVTFWELTEEEIDAYIALKEPLDKAGSYGIQGKGSIFVQHIQGDYYSVVGLPISRLVRE
LKQFNIDVTHA
Download sequence
Identical sequences B9IZ30
gi|222097901|ref|YP_002531958.1| 361100.BCQ_4242 WP_001226286.1.10762 WP_001226286.1.13024 WP_001226286.1.20687 WP_001226286.1.24184 WP_001226286.1.29209 WP_001226286.1.33045 WP_001226286.1.3318 WP_001226286.1.3615 WP_001226286.1.37093 WP_001226286.1.37990 WP_001226286.1.44463 WP_001226286.1.49428 WP_001226286.1.50316 WP_001226286.1.50514 WP_001226286.1.54775 WP_001226286.1.54782 WP_001226286.1.56055 WP_001226286.1.57203 WP_001226286.1.57815 WP_001226286.1.57859 WP_001226286.1.58814 WP_001226286.1.60274 WP_001226286.1.64377 WP_001226286.1.70645 WP_001226286.1.77690 WP_001226286.1.81088 WP_001226286.1.82533 WP_001226286.1.84337 WP_001226286.1.93932 WP_001226286.1.95457 WP_001226286.1.95484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]