SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|222097982|ref|YP_002532039.1| from Bacillus cereus Q1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222097982|ref|YP_002532039.1|
Domain Number 1 Region: 113-238
Classification Level Classification E-value
Superfamily alpha-helical ferredoxin 2.44e-26
Family Fumarate reductase/Succinate dehydogenase iron-sulfur protein, C-terminal domain 0.0016
Further Details:      
 
Domain Number 2 Region: 2-111
Classification Level Classification E-value
Superfamily 2Fe-2S ferredoxin-like 1.94e-22
Family 2Fe-2S ferredoxin domains from multidomain proteins 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222097982|ref|YP_002532039.1|
Sequence length 253
Comment succinate dehydrogenase iron-sulfur subunit [Bacillus cereus Q1]
Sequence
MSEKTIRLIITRQDGPDAQAFDQEFEIPYRPNMNIISALMEIRRNPVDSKGNKTTPIAWD
MNCLEEVCGACSMVINGKPRQSCTALIDQLEQPIRLKPMKTFPVVRDLQVDRSRMFNALK
RVKAWIPIDGTYDLGPGPRMPEKKRQWAYELSKCMTCGVCLESCPNVNSKSDFIGPAPLS
QARLFNSHPTGEMHKADRLRAIMGDGGLANCGNSQNCVQSCPKGIPLTTSIAALNRDTTI
QSFKDFFGSDNNY
Download sequence
Identical sequences A0A0F5RPT8 A0A0G8CGT9 A0A0J1HK85 A0A0T8X5S1 A0A154AX39 A0A1J9ZVJ8 A0A229MW83 A0A243CNK1 A0A243I4S5 A0A243NLZ2 A0A2K1S168 B3ZNL2 B7HRF9 B7JR20 B9J020 F0PZ50 J8DKE6 J8JPM6 Q633S5
WP_001291826.1.100241 WP_001291826.1.100409 WP_001291826.1.100684 WP_001291826.1.10069 WP_001291826.1.100873 WP_001291826.1.101309 WP_001291826.1.101843 WP_001291826.1.10762 WP_001291826.1.11044 WP_001291826.1.12289 WP_001291826.1.12751 WP_001291826.1.13024 WP_001291826.1.13221 WP_001291826.1.13299 WP_001291826.1.15163 WP_001291826.1.16156 WP_001291826.1.16199 WP_001291826.1.17408 WP_001291826.1.17424 WP_001291826.1.17899 WP_001291826.1.17927 WP_001291826.1.18840 WP_001291826.1.20687 WP_001291826.1.20865 WP_001291826.1.21643 WP_001291826.1.23100 WP_001291826.1.23873 WP_001291826.1.24184 WP_001291826.1.24377 WP_001291826.1.24676 WP_001291826.1.24709 WP_001291826.1.26000 WP_001291826.1.26499 WP_001291826.1.27334 WP_001291826.1.29209 WP_001291826.1.29451 WP_001291826.1.30216 WP_001291826.1.30336 WP_001291826.1.31685 WP_001291826.1.32522 WP_001291826.1.33045 WP_001291826.1.33061 WP_001291826.1.3318 WP_001291826.1.33828 WP_001291826.1.35255 WP_001291826.1.3615 WP_001291826.1.37093 WP_001291826.1.37990 WP_001291826.1.38425 WP_001291826.1.41365 WP_001291826.1.41976 WP_001291826.1.43533 WP_001291826.1.43762 WP_001291826.1.44463 WP_001291826.1.46244 WP_001291826.1.46476 WP_001291826.1.46549 WP_001291826.1.46746 WP_001291826.1.46864 WP_001291826.1.47097 WP_001291826.1.47441 WP_001291826.1.48010 WP_001291826.1.48164 WP_001291826.1.48311 WP_001291826.1.48599 WP_001291826.1.4865 WP_001291826.1.49056 WP_001291826.1.49428 WP_001291826.1.50316 WP_001291826.1.50514 WP_001291826.1.51087 WP_001291826.1.52756 WP_001291826.1.53879 WP_001291826.1.54775 WP_001291826.1.54782 WP_001291826.1.55057 WP_001291826.1.56055 WP_001291826.1.5628 WP_001291826.1.56318 WP_001291826.1.57203 WP_001291826.1.57245 WP_001291826.1.57565 WP_001291826.1.57815 WP_001291826.1.57859 WP_001291826.1.58037 WP_001291826.1.58328 WP_001291826.1.58814 WP_001291826.1.59173 WP_001291826.1.59773 WP_001291826.1.60274 WP_001291826.1.60841 WP_001291826.1.61231 WP_001291826.1.63611 WP_001291826.1.64377 WP_001291826.1.64491 WP_001291826.1.6753 WP_001291826.1.69970 WP_001291826.1.70645 WP_001291826.1.7096 WP_001291826.1.72514 WP_001291826.1.74337 WP_001291826.1.7545 WP_001291826.1.77576 WP_001291826.1.77690 WP_001291826.1.782 WP_001291826.1.79250 WP_001291826.1.79252 WP_001291826.1.79658 WP_001291826.1.79687 WP_001291826.1.80955 WP_001291826.1.80964 WP_001291826.1.81088 WP_001291826.1.82421 WP_001291826.1.82533 WP_001291826.1.82986 WP_001291826.1.83070 WP_001291826.1.84337 WP_001291826.1.8450 WP_001291826.1.87627 WP_001291826.1.8923 WP_001291826.1.89675 WP_001291826.1.90596 WP_001291826.1.91080 WP_001291826.1.91404 WP_001291826.1.91569 WP_001291826.1.91615 WP_001291826.1.9269 WP_001291826.1.93893 WP_001291826.1.93932 WP_001291826.1.94373 WP_001291826.1.95457 WP_001291826.1.95484 WP_001291826.1.95786 WP_001291826.1.99266 gi|218905740|ref|YP_002453574.1| gi|222097982|ref|YP_002532039.1| 288681.BCZK4263 361100.BCQ_4324 405534.BCAH187_A4644 405535.BCAH820_4628 gi|384182324|ref|YP_005568086.1| gi|52140987|ref|YP_085842.1| gi|217961999|ref|YP_002340569.1| gi|375286513|ref|YP_005106952.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]