SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257054112|ref|YP_003131944.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257054112|ref|YP_003131944.1|
Domain Number 1 Region: 110-295
Classification Level Classification E-value
Superfamily Rhomboid-like 3.27e-40
Family Rhomboid-like 0.0015
Further Details:      
 
Domain Number 2 Region: 40-82
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000435
Family B-box zinc-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257054112|ref|YP_003131944.1|
Sequence length 336
Comment membrane protein [Saccharomonospora viridis DSM 43017]
Sequence
MVSNHEVTDVGRECRSVDNTVTEPPNPPPYGQSQQQEALPGCWWHPGRQTGLRCVRCDRP
ACPDCLREASVGHQCIDCVTSARQQQRAQAEAYRRAGYGARTVVGARVPQRVVVVPLLIA
INVVIYALTAFQAGSVMDNHLSPVFEDGVLWPVAVVLFDEWWRLLASGFLHYGLLHLAMN
MLALWVLGRDLELLLGRIRFLAVYFLSMFAGAVAVFVFGAADTATAGASGAIYGLMGAVL
VAVLRLRLNATAAIGIIVLNIVISVSLPGISLLGHLGGLVAGALAMIAMVFAPERNRAAY
QAGAVAIMAAALAGLVVYRDAELFDQLCFHPVLCGF
Download sequence
Identical sequences C7MRQ5
gi|257054112|ref|YP_003131944.1| 471857.Svir_00270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]