SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257054582|ref|YP_003132414.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257054582|ref|YP_003132414.1|
Domain Number - Region: 56-124
Classification Level Classification E-value
Superfamily DhaL-like 0.00327
Family DhaL-like 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257054582|ref|YP_003132414.1|
Sequence length 152
Comment hypothetical protein Svir_05130 [Saccharomonospora viridis DSM 43017]
Sequence
MAETRGGAGAAQGGGFWEAITPLGFTMNSQTMDEVTRSADRMISSAKSGGFTVTKEAADP
IIKVLEDFITRIQEMKNELNVFNQIPPLGDHDYGKRVAHYMADAANDDRSARAAIDSLEI
VLEKSREALLRASNQYQENEESTKDVFKSLGG
Download sequence
Identical sequences C7MU59
471857.Svir_05130 WP_012796016.1.67378 gi|257054582|ref|YP_003132414.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]