SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257054976|ref|YP_003132808.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257054976|ref|YP_003132808.1|
Domain Number 1 Region: 4-142,175-222
Classification Level Classification E-value
Superfamily DhaL-like 1.01e-30
Family DhaL-like 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257054976|ref|YP_003132808.1|
Sequence length 554
Comment putative kinase, dihydroxyacetone kinase [Saccharomonospora viridis DSM 43017]
Sequence
MRALDAEAVRDWAEACVRDLRALRGEIDDINVYPVADSDTGSNLLHTMTAARNALAEVVP
PNAGAALTALADAAVRAAKGNSGIILSQVLRGMARSAGNAAELDGAALAAALRAADTAAT
AAVARPMAGTMLSVLHAVAVALDETFGSDFGSADRTTEATEAAEVTATTGPEPGEVATLA
AKIAADALAQTPHQLAPLAAAGVVDAGGRGLLVVLDALAEALTGVRKQSFDDVTDTTHAN
TAQQAWEVMYLLTVSDENRAAALSELRRALSELGDSVTVAEAGEAEYAIHVHCADIGAAL
EAGLDHGRPHHVRVEPLLTPKPPDTVAAGADRAVVAVVHGEALARLIEAEGTPVLTVAAD
REPTTEELLNLINGTAAAHVTVLPGGIHLTAAAERVTNHPMVAGRDVVVVPCSSPVQVLA
ALAVHDPGRRAGADVVAMAEAAAATRRGELTVAAEDAITWVGRVFAGDVLGFIDGEVVLV
EPRDTADRVERAAIGVLDRMLAVGGELVTVLVGDDAPAGIADVLAEHVRAERPDVELVCY
PGGQADAMLLIGVE
Download sequence
Identical sequences C7MY33
WP_012796410.1.67378 gi|257054976|ref|YP_003132808.1| 471857.Svir_09230

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]