SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257055115|ref|YP_003132947.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|257055115|ref|YP_003132947.1|
Domain Number - Region: 15-124
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 0.0471
Family Formate dehydrogenase N, cytochrome (gamma) subunit 0.049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257055115|ref|YP_003132947.1|
Sequence length 139
Comment hypothetical protein Svir_10640 [Saccharomonospora viridis DSM 43017]
Sequence
MKVEARVFDIVAIFGIVIAIIYAVMTGIMTQDGVEPVGTVALLLSGGLALLVGSYFRFVA
RRIEPRPEDHEDAEISDGAGELGFFSPGSYWPVVVAAGCALVSVALAFFQVWLIILSGIL
LVMAIGGLVFEYHTGPRRQ
Download sequence
Identical sequences A0A1I5T535 C7MYZ9
471857.Svir_10640 WP_015785435.1.37385 WP_015785435.1.67378 WP_015785435.1.81884 gi|257055115|ref|YP_003132947.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]