SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257055887|ref|YP_003133719.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257055887|ref|YP_003133719.1|
Domain Number 1 Region: 89-320
Classification Level Classification E-value
Superfamily PA domain 1.16e-74
Family PA domain 0.0000132
Further Details:      
 
Domain Number 2 Region: 36-83,302-537
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 1.04e-65
Family FolH catalytic domain-like 0.00012
Further Details:      
 
Domain Number 3 Region: 538-671
Classification Level Classification E-value
Superfamily Transferrin receptor-like dimerisation domain 1.57e-21
Family Transferrin receptor-like dimerisation domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257055887|ref|YP_003133719.1|
Sequence length 678
Comment putative aminopeptidase [Saccharomonospora viridis DSM 43017]
Sequence
MLGATVLTAGLLVGLTTGATGEPHTPVDSRSWERALQAEVDADSAARLSEALSTYPGLTG
TEGAARRAAYSIDMLTSWGLDARVESYEVYASVPKDISVTMTGPERRRLEVKEPPFAWHE
DFDDVVVGYNAYSPAGDVTADVVYVNYGLPEDYATLKDLGVDVEGKIVLARYGNSFRGVK
SQVAEEHGAAGVILYSDPADDGFTRGPVYPDGPWRNADGIQRGSVQYLFRYPGDPLTPGA
PSIPGTPRLDPADAENLPRIPTTPISYGQARYLLAALDGPRAPKEWQGGLDLGYRIGPGP
TTVHLDLDIDYEQIPINDVIAEIPGSVHPEQKVVLGAHYDSWAYGTKDDVSGWATLMETA
RALATLHDRGWRPERTIVLAGWDGEEYGLLGSTEWAEDHRADLVENAVVYLNMDGAGGGV
DFSAASVPALDDVLVDIAKTVEDPHHGTVYANWQRSSGDRRPVPGRLGSGSDYTVFLDHL
GIASADFGTSTPSGEYHSAYDDLHMMRNFLDPDYAYHAVAAAYAGTFALRMADSDVLPLV
YSDYAREVVRHLREVDDAQVGDPVVDLGPAYDAARGWQVAAQRLENAARNARGDERDTLN
EALLAQERALVHKEGLPGREWFKHMVYAPGFYTGYAAQPLSAIDDAVTEGDVATATKYRD
LLIESMEQATEVAHRATG
Download sequence
Identical sequences C7MUB3
471857.Svir_18700 WP_015786205.1.67378 gi|257055887|ref|YP_003133719.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]