SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257056452|ref|YP_003134284.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257056452|ref|YP_003134284.1|
Domain Number 1 Region: 13-122
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.77e-33
Family Bacterial S-adenosylmethionine decarboxylase 0.00047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|257056452|ref|YP_003134284.1|
Sequence length 129
Comment S-adenosylmethionine decarboxylase proenzyme [Saccharomonospora viridis DSM 43017]
Sequence
MPSEFVPVGVFSGKHVLAELDGIDARLLDDDEFLRSTLADTLTDAGATVCEVISHRFEPQ
GVTVLAMLAESHASVHTYPEIGAMFVDVFTCGERADPEHAVRLLAKALGTEPVSMSTITR
GRQPTNTGK
Download sequence
Identical sequences A0A1I5TT18 C7MZ90
471857.Svir_24630 WP_015786769.1.37385 WP_015786769.1.67378 WP_015786769.1.81884 gi|257056452|ref|YP_003134284.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]