SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257055159|ref|YP_003132991.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257055159|ref|YP_003132991.1|
Domain Number 1 Region: 26-248
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.49e-52
Family ThuA-like 0.0067
Further Details:      
 
Domain Number 2 Region: 910-1036
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.12e-24
Family Family 6 carbohydrate binding module, CBM6 0.00031
Further Details:      
 
Domain Number 3 Region: 256-710
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 5.23e-23
Family Soluble quinoprotein glucose dehydrogenase 0.0025
Further Details:      
 
Domain Number 4 Region: 712-800
Classification Level Classification E-value
Superfamily PKD domain 4.71e-18
Family PKD domain 0.001
Further Details:      
 
Weak hits

Sequence:  gi|257055159|ref|YP_003132991.1|
Domain Number - Region: 1265-1319
Classification Level Classification E-value
Superfamily E set domains 0.000112
Family Molybdenum-containing oxidoreductases-like dimerisation domain 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|257055159|ref|YP_003132991.1|
Sequence length 1505
Comment glucose/sorbosone dehydrogenase [Saccharomonospora viridis DSM 43017]
Sequence
MALCTGLGSGGFTLTAAAEEAQPEASVLVFSKTAGFRHDSIPAGIEAIEQLGAEHNFAVD
ATEDAEAFTDDNLANYDAVVWLSTTGDVLNDEQQAAFERYISEGGGYVGVHAASDTEYDW
PWYGDLVGAYFDSHPHIQEATVNVEDRGHPSTADLPEQWVRTDEWYNYRENPRQNVRVLA
TLDEGSYDPGSGAMGDDHPIAWCHENSGGRAWYTGGGHTVESFSEPEFLAHLAGGIQYAA
GLTDADCSTTDEPEPEAPVDSDFDQITLARGADVTGEPMALSVLPDGRVLHTSRDGRVFL
TTPEGNTSVAATLDVYNHDEDGLQGIAVDPNFEENHWVYLYYAPPLDTPPGDAPENGSPE
DFEPFKGYNQLSRFKLTDEGTLDLSSEQQILQVPADRGICCHAGGEIDFDADGNLLLSTG
DDTNPFASDGYTPIDERSNRNPAFDAQRSSGNTNDLRGKILRITVQEDGSYTIPEGNLFE
PGTEKTRPEIYAMGFRNPFRFAVDKETGWIYVGDYGPDAGSANPDRGPAGTVEFNLVTGP
GNYGWPYCVGDNEPFIDYDFESGTPGEAFDCSAPVNDSPNNTGLTELPPAQPAWIPYDGG
SVPEFGTGGESPMGGPVYRFDPELESNTKFPEYYDGKNFAYEWDRGWIKTIEVGENGERG
AIEPFFESMELTRPMNIEFGPEGSLYVLDYGSGYFGGAEDSALYRIDYTKGNRTPQVSLS
ADVTSGQAPLEVTFEPSAEDADGDELTFAWDFDGDGETDSTEAGPVTHTYTENGQYHAKL
SVTDPGGLSGSASVVITVGNTEPTVKLETPVNGGFFGFGDLVPFTVTVTDPEDGEIDCSK
VTVEYILGHDNHGHPLSRASGCEGVIETPADEGHGLDAHIFGVIDARYTDNGGAEGVPAL
TGSDQNILQPKIKQAEFFTELEGVEVVTASGASGGKRVGYIDDGDWIKLDPVNLVGVDSI
TYRVSSGGPGGTIEARAGALDGPVVHTVEVPNTGGWDSYTEVGPVEVTDPGGTQPLYLVF
HGEGDGGLFDVDVLHVNGAGVAQPGTSPAECEPAEPEEGYRMLFDGTAASLENWNQAGPG
SFELGDDCTIKSVGGMGLLWYDEQFGAYSLKLDWKMAGDDNSGVFVGFPDPGDDPWVAVN
EGYEIQIDPTDDPDKTTGAIYGFQSADLEARDAALNPPGEWNSYEIVVRDQTIQVYLNDT
LINDFVSTDPNRDLTQGFVGLQNHGDEDEVWFRNVQIRDLDTTAPATEASFAEPGANGWH
NGEVGVTLTATDEGSGVERIEYSLDGGDWTTYTEPVVISGDGEHTMLYRAVDKAGNVEND
KAVTIRIDGTAPTVMIAGVADGFVYGDAEELTISWEARDGTSGVESAAAELDGEALESGT
TVPLYPLDLGEHSLTVSATDKAGNTAEHTLTFTSTTSFDDVASLIRRFAAEDKLTTAEKV
VLSAELALAKRASEGGRTTPAVVLMRLFIGMAQHVSDDDARDTLVRDGRALLGHIDGSAP
IPVVS
Download sequence
Identical sequences C7MZ43
gi|257055159|ref|YP_003132991.1| 471857.Svir_11080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]