SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|257055278|ref|YP_003133110.1| from Saccharomonospora viridis DSM 43017

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|257055278|ref|YP_003133110.1|
Domain Number 1 Region: 36-263
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.52e-36
Family STM3548-like 0.061
Further Details:      
 
Domain Number 2 Region: 272-413,446-687
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 7.72e-31
Family Soluble quinoprotein glucose dehydrogenase 0.00038
Further Details:      
 
Domain Number 3 Region: 702-789
Classification Level Classification E-value
Superfamily PKD domain 1.83e-21
Family PKD domain 0.00097
Further Details:      
 
Domain Number 4 Region: 898-1022
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.44e-21
Family Family 6 carbohydrate binding module, CBM6 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|257055278|ref|YP_003133110.1|
Sequence length 1200
Comment glucose/sorbosone dehydrogenase [Saccharomonospora viridis DSM 43017]
Sequence
MSRRKRLLSRLGAIALGGLLTAGTVPAIAQAQEAEFHALLFTKTEGYRHDSIPAGIEMFE
NLAAENNFTFDHTEDSSVFNDDDLAAYDVVIMFQTSGMVWENDAQREAIQNYVENGGGIA
AIHNATDMGIENEFPWWDELVNAGAHMPSHSPGVLEGTAKVTDRHHPSTEGLPARWERAE
EWYNFDRSMRGKVHVLVSVDESTYDPGPDAMGADHPISWCRDVGLSRVWATAMGHDSAAY
SEEAFVQHILGGVRTAARVVEADCSATVDAAFEKVALDVNTQAPTAMDVAPDGRVFYTEI
LGRVMVYHPETESTFTALEIPVYSGGEDGLVGLVLDPDFSDNGWIYLYYSPPGDEEINRV
SRFTVEGDTISLDSEVQIIDIPASRRSEPGHTGGYLTFGPEGDLYIGVGDDTNPFESNGY
TPIDEREGRDLFDAQKTSANTNDLRGKILRITPQAEGGYTIPEGNMFAPGAENTRPEIYA
MGFRNPYRFTVDVDGTLYLADYGPDAGEADPERGPDGKVEWNIVRKPGFYGWPYCIGNNI
PYNDYDFATGTSGEKFDCENPVNDSPNNTGLTELPPAQPADVWYGYGESEEFPILGTGGS
APMGGPVYRYDPELESEIKFPEYYDGKAFFYEWARNRIYTITFDEQGEVLNLDPWLVSEQ
TMAPMDMRFGPDGAMYLLEWGGGYGRDNPDSGLYRIEYNQGNRRPIVEVGATVTSGQAPL
EVSFTSEGSHDPEGTDVTYSWDFGDGATSTEANPTYTFTEHGQYNVQLTVTDATGKTGVG
NVTVTVGNTAPTVSVAAPVNGGFFDFGDHVAFEVDVTDPEDGEIDCGEVVVQPALGHDAH
AHPMDPINACEGVIETIVDDGHAGANIFYSIDASYTDHGGIDAPRLIGRDTVILQPKHKQ
AEYFTSSEGIRIVHAEGAENGKRIGDIDDGDWIAFTPVNFAGIDEVSLRVSAPEGAGGSV
ELRAGAVDGQVVATVEVPSTGGWDNYEDLPPVPVTDPGETTELFVVFRGEIASPFDLDSL
TFLGDGVAQVDDEAPEISVTGVADGASYGDSTDLILGWEATDSGSGIASVEAELGGKPIE
NGAEIPLYTVDLGEQEFVITATDRAGNTAERKVTFTVVTSLTDLRALVARFADEDRISGK
TATRLTVLFSLVEGVKRISPHAAAWVLTLAVSDMEKRISDTEAKDVLVRDARSLIDSWRT
Download sequence
Identical sequences C7MPN8
gi|257055278|ref|YP_003133110.1| 471857.Svir_12340 WP_015785598.1.67378

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]