SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253797028|ref|YP_003030029.1| from Mycobacterium tuberculosis KZN 1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253797028|ref|YP_003030029.1|
Domain Number 1 Region: 70-247
Classification Level Classification E-value
Superfamily Rhomboid-like 2.88e-43
Family Rhomboid-like 0.0031
Further Details:      
 
Domain Number 2 Region: 5-45
Classification Level Classification E-value
Superfamily B-box zinc-binding domain 0.0000174
Family B-box zinc-binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253797028|ref|YP_003030029.1|
Sequence length 284
Comment hypothetical protein TBMG_00111 [Mycobacterium tuberculosis KZN 1435]
Sequence
MSGASSSESPTCYRHPGRRTYVRCTRCDRYICGECMRVGPVGHQCAECVREGARAVRQPR
TPFGGRQRSATPVVTYTLISLNALVFVMQVTVMGLERQLALWPPAVASGQTYRLVTSAFL
HYGAMHLLLNMWALYVVGPPLEMWLGRLRFGALYAVSALGGSVLVYLIAPLNTATAGASG
AVFGLFGATFMVARRLHLDVRWVVALIVINLAFTFLAPAISWQGHVGGLVTGALVAATYV
YAPRERRNLIQATVTITVLVAFVVLIGWRTVDLLALFGGRLNLS
Download sequence
Identical sequences A0A089QKM3 A0A197J5B8 A0A1S1B853 E2IBS3 E2IBS5 E2IBS7 E2IBS9 Q7DAG7
WP_003899818.1.21403 WP_003899818.1.9514 gi|375294312|ref|YP_005098579.1| gi|15839491|ref|NP_334528.1| gi|148821302|ref|YP_001286056.1| gi|544161339|ref|YP_002159409.2| 336982.TBFG_10111 478434.TBMG_00111 83331.MT0119 gi|392430521|ref|YP_006471565.1| gi|253797028|ref|YP_003030029.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]