SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253799042|ref|YP_003032043.1| from Mycobacterium tuberculosis KZN 1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253799042|ref|YP_003032043.1|
Domain Number 1 Region: 60-204
Classification Level Classification E-value
Superfamily PEBP-like 5.63e-37
Family Prokaryotic PEBP-like proteins 0.0037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253799042|ref|YP_003032043.1|
Sequence length 205
Comment hypothetical protein TBMG_02081 [Mycobacterium tuberculosis KZN 1435]
Sequence
MESPMTSTLHRTPLATAGLALVVALGGCGGGGGDSRETPPYVPKATTVDATTPAPAAEPL
TIASPMFADGAPIPVQFSCKGANVAPPLTWSSPAGAAELALVVDDPDAVGGLYVHWIVTG
IAPGSGSTADGQTPAGGHSVPNSGGRQGYFGPCPPAGTGTHHYRFTLYHLPVALQLPPGA
TGVQAAQAIAQAASGQARLVGTFEG
Download sequence
Identical sequences A0A089QLU2 P9WFN2
gi|392432505|ref|YP_006473549.1| 478434.TBMG_02081 83331.MT1962 gi|15841383|ref|NP_336420.1| gi|253799042|ref|YP_003032043.1| gi|449063979|ref|YP_007431062.1| gi|375296292|ref|YP_005100559.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]