SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253799043|ref|YP_003032044.1| from Mycobacterium tuberculosis KZN 1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253799043|ref|YP_003032044.1|
Domain Number 1 Region: 62-202
Classification Level Classification E-value
Superfamily PEBP-like 1.83e-30
Family Prokaryotic PEBP-like proteins 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|253799043|ref|YP_003032044.1|
Sequence length 204
Comment hypothetical protein TBMG_02082 [Mycobacterium tuberculosis KZN 1435]
Sequence
MINMESTVAHAFHRFALAILGLALPVALVAYGGNGDSRKAAPLAPKAAALGRSMPETPTG
DVLTISSPAFADGAPIPEQYTCKGANIAPPLTWSAPFGGALVVDDPDAPREPYVHWIVIG
IAPGAGSTADGETPGGGISLPNSSGQPAYTGPCPPAGTGTHHYRFTLYHLPAVPPLAGLA
GTQAARVIAQAATMQARLIGTYEG
Download sequence
Identical sequences A0A0E8MT80 A0A0H3L9S1 A0A120IP53 A0A120IX11 A0A120J1C7
gi|148823122|ref|YP_001287876.1| gi|544161772|ref|YP_002161862.2| gi|375296293|ref|YP_005100560.1| 336982.TBFG_11939 478434.TBMG_02082 gi|471337860|ref|YP_007610573.1| gi|253799043|ref|YP_003032044.1| gi|392432506|ref|YP_006473550.1| gi|525674570|ref|YP_008226013.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]