SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253799645|ref|YP_003032646.1| from Mycobacterium tuberculosis KZN 1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253799645|ref|YP_003032646.1|
Domain Number 1 Region: 3-301
Classification Level Classification E-value
Superfamily ATP synthase (F1-ATPase), gamma subunit 1.7e-80
Family ATP synthase (F1-ATPase), gamma subunit 0.0000397
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253799645|ref|YP_003032646.1|
Sequence length 305
Comment ATP synthase F0F1 subunit gamma [Mycobacterium tuberculosis KZN 1435]
Sequence
MAATLRELRGRIRSAGSIKKITKAQELIATSRIARAQARLESARPYAFEITRMLTTLAAE
AALDHPLLVERPEPKRAGVLVVSSDRGLCGAYNANIFRRSEELFSLLREAGKQPVLYVVG
RKAQNYYSFRNWNITESWMGFSEQPTYENAAEIASTLVDAFLLGTDNGEDQRSDSGEGVD
ELHIVYTEFKSMLSQSAEAHRIAPMVVEYVEEDIGPRTLYSFEPDATMLFESLLPRYLTT
RVYAALLESAASELASRQRAMKSATDNADDLIKALTLMANRERQAQITQEISEIVGGANA
LAEAR
Download sequence
Identical sequences A0A045J1D3 A0A083WDP9 A0A0H3L814 A0A0K2HVQ3 A0A109SW01 A0A197J3Q0 A1KI97 A5U208 C1AMV3 F8M6P1 G0THY7 I6YA77 P63672 P9WPU8 P9WPU9 R4MCL4
gi|385990736|ref|YP_005909034.1| gi|15608449|ref|NP_215825.1| 233413.Mb1341 336982.TBFG_11336 410289.BCG_1369 419947.MRA_1317 478434.TBMG_02671 561275.JTY_1344 83331.MT1349 83332.Rv1309 gi|385998093|ref|YP_005916391.1| gi|471337228|ref|YP_007609941.1| gi|525674045|ref|YP_008225417.1| gi|494699719|ref|YP_007965201.1| gi|339631377|ref|YP_004723019.1| gi|392433096|ref|YP_006474140.1| gi|506925777|ref|YP_008006227.1| gi|433641463|ref|YP_007287222.1| gi|224989713|ref|YP_002644400.1| gi|15608449|ref|NP_215825.1| gi|433626410|ref|YP_007260039.1| gi|479314214|ref|YP_007854266.1| NP_215825.1.84033 WP_003898819.1.100000 WP_003898819.1.100021 WP_003898819.1.100069 WP_003898819.1.100087 WP_003898819.1.10015 WP_003898819.1.100208 WP_003898819.1.100216 WP_003898819.1.10022 WP_003898819.1.100255 WP_003898819.1.100260 WP_003898819.1.100270 WP_003898819.1.100279 WP_003898819.1.100286 WP_003898819.1.100308 WP_003898819.1.100309 WP_003898819.1.100318 WP_003898819.1.100338 WP_003898819.1.10037 WP_003898819.1.100383 WP_003898819.1.100395 WP_003898819.1.100396 WP_003898819.1.1004 WP_003898819.1.100401 WP_003898819.1.100459 WP_003898819.1.100460 WP_003898819.1.100552 WP_003898819.1.100581 WP_003898819.1.100600 WP_003898819.1.100625 WP_003898819.1.10064 WP_003898819.1.100666 WP_003898819.1.100671 WP_003898819.1.100677 WP_003898819.1.100682 WP_003898819.1.100697 WP_003898819.1.100703 WP_003898819.1.100716 WP_003898819.1.100722 WP_003898819.1.100754 WP_003898819.1.100757 WP_003898819.1.100772 WP_003898819.1.1008 WP_003898819.1.100812 WP_003898819.1.100866 WP_003898819.1.10088 WP_003898819.1.100889 WP_003898819.1.10090 WP_003898819.1.100910 WP_003898819.1.100915 WP_003898819.1.100918 WP_003898819.1.100935 WP_003898819.1.100992 WP_003898819.1.100998 WP_003898819.1.101 WP_003898819.1.101025 WP_003898819.1.101028 WP_003898819.1.10104 WP_003898819.1.101048 WP_003898819.1.101054 WP_003898819.1.101075 WP_003898819.1.101143 WP_003898819.1.101146 WP_003898819.1.10116 WP_003898819.1.10117 WP_003898819.1.101209 WP_003898819.1.10125 WP_003898819.1.101290 WP_003898819.1.101323 WP_003898819.1.101324 WP_003898819.1.101350 WP_003898819.1.101367 WP_003898819.1.101398 WP_003898819.1.101403 WP_003898819.1.101421 WP_003898819.1.10144 WP_003898819.1.101442 WP_003898819.1.10145 WP_003898819.1.101452 WP_003898819.1.101456 WP_003898819.1.101481 WP_003898819.1.101493 WP_003898819.1.101496 WP_003898819.1.101525 WP_003898819.1.101533 WP_003898819.1.101535 WP_003898819.1.101553 WP_003898819.1.101558 WP_003898819.1.10156 WP_003898819.1.101573 WP_003898819.1.101576 WP_003898819.1.10159 WP_003898819.1.101592 WP_003898819.1.101604 WP_003898819.1.101607 WP_003898819.1.101622 WP_003898819.1.101644 WP_003898819.1.101659 WP_003898819.1.101671 WP_003898819.1.101687 WP_003898819.1.101698 WP_003898819.1.10170 WP_003898819.1.101713 WP_003898819.1.101733 WP_003898819.1.101743 WP_003898819.1.101753 WP_003898819.1.101764 WP_003898819.1.101773 WP_003898819.1.101795 WP_003898819.1.101797 WP_003898819.1.101798 WP_003898819.1.101802 WP_003898819.1.101826 WP_003898819.1.101836 WP_003898819.1.101858 WP_003898819.1.101859 WP_003898819.1.101862 WP_003898819.1.101888 WP_003898819.1.101894 WP_003898819.1.101899 WP_003898819.1.1019 WP_003898819.1.101923 WP_003898819.1.101925 WP_003898819.1.10193 WP_003898819.1.101996 WP_003898819.1.102 WP_003898819.1.102008 WP_003898819.1.102017 WP_003898819.1.102053 WP_003898819.1.102055 WP_003898819.1.102063 WP_003898819.1.102099 WP_003898819.1.1021 WP_003898819.1.10211 WP_003898819.1.102119 WP_003898819.1.102121 WP_003898819.1.102143 WP_003898819.1.10216 WP_003898819.1.10224 WP_003898819.1.10253 WP_003898819.1.10262 WP_003898819.1.10277 WP_003898819.1.1033 WP_003898819.1.10350 WP_003898819.1.10362 WP_003898819.1.10366 WP_003898819.1.10376 WP_003898819.1.10396 WP_003898819.1.10410 WP_003898819.1.10414 WP_003898819.1.10421 WP_003898819.1.10430 WP_003898819.1.1044 WP_003898819.1.10440 WP_003898819.1.10445 WP_003898819.1.10471 WP_003898819.1.10472 WP_003898819.1.10489 WP_003898819.1.105 WP_003898819.1.10518 WP_003898819.1.10523 WP_003898819.1.10545 WP_003898819.1.1057 WP_003898819.1.10594 WP_003898819.1.10603 WP_003898819.1.10606 WP_003898819.1.10615 WP_003898819.1.10623 WP_003898819.1.10635 WP_003898819.1.10643 WP_003898819.1.10648 WP_003898819.1.10662 WP_003898819.1.10709 WP_003898819.1.10735 WP_003898819.1.10740 WP_003898819.1.10756 WP_003898819.1.1078 WP_003898819.1.10791 WP_003898819.1.10799 WP_003898819.1.10825 WP_003898819.1.10848 WP_003898819.1.10863 WP_003898819.1.10879 WP_003898819.1.10912 WP_003898819.1.10916 WP_003898819.1.10923 WP_003898819.1.10927 WP_003898819.1.1095 WP_003898819.1.10956 WP_003898819.1.10958 WP_003898819.1.10962 WP_003898819.1.10980 WP_003898819.1.10981 WP_003898819.1.10993 WP_003898819.1.1100 WP_003898819.1.11040 WP_003898819.1.11061 WP_003898819.1.11070 WP_003898819.1.11141 WP_003898819.1.11171 WP_003898819.1.11175 WP_003898819.1.11176 WP_003898819.1.11222 WP_003898819.1.11236 WP_003898819.1.11329 WP_003898819.1.1133 WP_003898819.1.11342 WP_003898819.1.11373 WP_003898819.1.11376 WP_003898819.1.11390 WP_003898819.1.11402 WP_003898819.1.11481 WP_003898819.1.11487 WP_003898819.1.11489 WP_003898819.1.11491 WP_003898819.1.11514 WP_003898819.1.11587 WP_003898819.1.11589 WP_003898819.1.11596 WP_003898819.1.11604 WP_003898819.1.11610 WP_003898819.1.11697 WP_003898819.1.11707 WP_003898819.1.11752 WP_003898819.1.11758 WP_003898819.1.11761 WP_003898819.1.11775 WP_003898819.1.11804 WP_003898819.1.11822 WP_003898819.1.11826 WP_003898819.1.11856 WP_003898819.1.11898 WP_003898819.1.11906 WP_003898819.1.11939 WP_003898819.1.11960 WP_003898819.1.11961 WP_003898819.1.11972 WP_003898819.1.11984 WP_003898819.1.12001 WP_003898819.1.12049 WP_003898819.1.12052 WP_003898819.1.12100 WP_003898819.1.12116 WP_003898819.1.12161 WP_003898819.1.12165 WP_003898819.1.12184 WP_003898819.1.12187 WP_003898819.1.12190 WP_003898819.1.12216 WP_003898819.1.12265 WP_003898819.1.12275 WP_003898819.1.12293 WP_003898819.1.12294 WP_003898819.1.1231 WP_003898819.1.12314 WP_003898819.1.12327 WP_003898819.1.12338 WP_003898819.1.1236 WP_003898819.1.12371 WP_003898819.1.12372 WP_003898819.1.12389 WP_003898819.1.12406 WP_003898819.1.1241 WP_003898819.1.12421 WP_003898819.1.12424 WP_003898819.1.12446 WP_003898819.1.12464 WP_003898819.1.12479 WP_003898819.1.12519 WP_003898819.1.12523 WP_003898819.1.12526 WP_003898819.1.1255 WP_003898819.1.12550 WP_003898819.1.12551 WP_003898819.1.12563 WP_003898819.1.12611 WP_003898819.1.12669 WP_003898819.1.1267 WP_003898819.1.12672 WP_003898819.1.12692 WP_003898819.1.1271 WP_003898819.1.12710 WP_003898819.1.12768 WP_003898819.1.1279 WP_003898819.1.12794 WP_003898819.1.12801 WP_003898819.1.12804 WP_003898819.1.12821 WP_003898819.1.12841 WP_003898819.1.12854 WP_003898819.1.12871 WP_003898819.1.12901 WP_003898819.1.12941 WP_003898819.1.12947 WP_003898819.1.12957 WP_003898819.1.12972 WP_003898819.1.13028 WP_003898819.1.13043 WP_003898819.1.13086 WP_003898819.1.13087 WP_003898819.1.13090 WP_003898819.1.13096 WP_003898819.1.13163 WP_003898819.1.13175 WP_003898819.1.13183 WP_003898819.1.132 WP_003898819.1.13249 WP_003898819.1.13282 WP_003898819.1.13284 WP_003898819.1.13296 WP_003898819.1.13298 WP_003898819.1.13302 WP_003898819.1.13306 WP_003898819.1.13312 WP_003898819.1.13313 WP_003898819.1.13321 WP_003898819.1.13345 WP_003898819.1.13358 WP_003898819.1.13370 WP_003898819.1.13375 WP_003898819.1.1338 WP_003898819.1.13420 WP_003898819.1.13433 WP_003898819.1.13435 WP_003898819.1.13438 WP_003898819.1.13461 WP_003898819.1.13466 WP_003898819.1.13489 WP_003898819.1.13526 WP_003898819.1.13551 WP_003898819.1.13561 WP_003898819.1.13564 WP_003898819.1.13579 WP_003898819.1.13647 WP_003898819.1.13667 WP_003898819.1.13697 WP_003898819.1.13719 WP_003898819.1.13763 WP_003898819.1.1377 WP_003898819.1.13774 WP_003898819.1.13786 WP_003898819.1.13793 WP_003898819.1.13794 WP_003898819.1.13817 WP_003898819.1.13834 WP_003898819.1.13866 WP_003898819.1.13880 WP_003898819.1.13899 WP_003898819.1.13909 WP_003898819.1.13910 WP_003898819.1.13919 WP_003898819.1.13920 WP_003898819.1.13952 WP_003898819.1.13953 WP_003898819.1.13962 WP_003898819.1.1398 WP_003898819.1.13988 WP_003898819.1.14027 WP_003898819.1.14046 WP_003898819.1.14115 WP_003898819.1.1415 WP_003898819.1.14152 WP_003898819.1.14158 WP_003898819.1.14162 WP_003898819.1.14175 WP_003898819.1.14178 WP_003898819.1.14194 WP_003898819.1.14195 WP_003898819.1.14208 WP_003898819.1.14238 WP_003898819.1.14266 WP_003898819.1.14273 WP_003898819.1.14303 WP_003898819.1.14306 WP_003898819.1.14307 WP_003898819.1.14310 WP_003898819.1.14341 WP_003898819.1.14382 WP_003898819.1.14416 WP_003898819.1.14428 WP_003898819.1.14441 WP_003898819.1.14469 WP_003898819.1.14477 WP_003898819.1.14504 WP_003898819.1.14514 WP_003898819.1.1452 WP_003898819.1.14527 WP_003898819.1.1454 WP_003898819.1.14544 WP_003898819.1.14548 WP_003898819.1.14551 WP_003898819.1.14561 WP_003898819.1.14573 WP_003898819.1.1462 WP_003898819.1.14658 WP_003898819.1.14667 WP_003898819.1.14668 WP_003898819.1.14675 WP_003898819.1.14694 WP_003898819.1.14709 WP_003898819.1.14766 WP_003898819.1.14783 WP_003898819.1.14865 WP_003898819.1.14872 WP_003898819.1.14905 WP_003898819.1.14926 WP_003898819.1.14951 WP_003898819.1.14955 WP_003898819.1.15003 WP_003898819.1.15009 WP_003898819.1.15028 WP_003898819.1.15040 WP_003898819.1.15052 WP_003898819.1.15065 WP_003898819.1.15072 WP_003898819.1.15089 WP_003898819.1.1509 WP_003898819.1.15126 WP_003898819.1.15131 WP_003898819.1.15168 WP_003898819.1.15174 WP_003898819.1.15187 WP_003898819.1.15196 WP_003898819.1.15210 WP_003898819.1.15216 WP_003898819.1.15217 WP_003898819.1.1523 WP_003898819.1.15232 WP_003898819.1.15238 WP_003898819.1.15240 WP_003898819.1.15253 WP_003898819.1.15267 WP_003898819.1.1527 WP_003898819.1.15292 WP_003898819.1.15299 WP_003898819.1.15302 WP_003898819.1.15322 WP_003898819.1.1534 WP_003898819.1.15345 WP_003898819.1.15372 WP_003898819.1.15386 WP_003898819.1.15387 WP_003898819.1.15447 WP_003898819.1.15449 WP_003898819.1.15477 WP_003898819.1.15481 WP_003898819.1.15492 WP_003898819.1.15511 WP_003898819.1.15512 WP_003898819.1.15558 WP_003898819.1.15559 WP_003898819.1.15566 WP_003898819.1.15599 WP_003898819.1.1560 WP_003898819.1.15611 WP_003898819.1.1563 WP_003898819.1.15633 WP_003898819.1.15643 WP_003898819.1.15688 WP_003898819.1.15755 WP_003898819.1.15763 WP_003898819.1.15774 WP_003898819.1.1578 WP_003898819.1.15780 WP_003898819.1.15834 WP_003898819.1.15842 WP_003898819.1.15848 WP_003898819.1.15853 WP_003898819.1.15870 WP_003898819.1.15877 WP_003898819.1.15893 WP_003898819.1.15896 WP_003898819.1.15926 WP_003898819.1.15933 WP_003898819.1.15946 WP_003898819.1.15958 WP_003898819.1.15973 WP_003898819.1.15987 WP_003898819.1.15993 WP_003898819.1.16009 WP_003898819.1.16025 WP_003898819.1.16043 WP_003898819.1.16066 WP_003898819.1.16069 WP_003898819.1.16077 WP_003898819.1.16106 WP_003898819.1.16108 WP_003898819.1.16110 WP_003898819.1.16130 WP_003898819.1.16136 WP_003898819.1.16139 WP_003898819.1.16141 WP_003898819.1.16143 WP_003898819.1.1630 WP_003898819.1.16318 WP_003898819.1.1632 WP_003898819.1.16327 WP_003898819.1.16334 WP_003898819.1.16341 WP_003898819.1.16345 WP_003898819.1.16374 WP_003898819.1.16384 WP_003898819.1.16386 WP_003898819.1.164 WP_003898819.1.1642 WP_003898819.1.16421 WP_003898819.1.16424 WP_003898819.1.16426 WP_003898819.1.16431 WP_003898819.1.16438 WP_003898819.1.1644 WP_003898819.1.16442 WP_003898819.1.16448 WP_003898819.1.16451 WP_003898819.1.16476 WP_003898819.1.16480 WP_003898819.1.16494 WP_003898819.1.1652 WP_003898819.1.16549 WP_003898819.1.16560 WP_003898819.1.16598 WP_003898819.1.16609 WP_003898819.1.16619 WP_003898819.1.16620 WP_003898819.1.16622 WP_003898819.1.16637 WP_003898819.1.1669 WP_003898819.1.16707 WP_003898819.1.16724 WP_003898819.1.16731 WP_003898819.1.16743 WP_003898819.1.1683 WP_003898819.1.16837 WP_003898819.1.16852 WP_003898819.1.16937 WP_003898819.1.16940 WP_003898819.1.16950 WP_003898819.1.16959 WP_003898819.1.16968 WP_003898819.1.1697 WP_003898819.1.16973 WP_003898819.1.16977 WP_003898819.1.16987 WP_003898819.1.17005 WP_003898819.1.17006 WP_003898819.1.17010 WP_003898819.1.17015 WP_003898819.1.17019 WP_003898819.1.17039 WP_003898819.1.17041 WP_003898819.1.17052 WP_003898819.1.17057 WP_003898819.1.17062 WP_003898819.1.1707 WP_003898819.1.17094 WP_003898819.1.17130 WP_003898819.1.17138 WP_003898819.1.17147 WP_003898819.1.17167 WP_003898819.1.17224 WP_003898819.1.17251 WP_003898819.1.17288 WP_003898819.1.17304 WP_003898819.1.17314 WP_003898819.1.17345 WP_003898819.1.17381 WP_003898819.1.17391 WP_003898819.1.17412 WP_003898819.1.1743 WP_003898819.1.17440 WP_003898819.1.17466 WP_003898819.1.17477 WP_003898819.1.17483 WP_003898819.1.17505 WP_003898819.1.17527 WP_003898819.1.17535 WP_003898819.1.17540 WP_003898819.1.17553 WP_003898819.1.17558 WP_003898819.1.17599 WP_003898819.1.17635 WP_003898819.1.17655 WP_003898819.1.17679 WP_003898819.1.1768 WP_003898819.1.17687 WP_003898819.1.17700 WP_003898819.1.17710 WP_003898819.1.17713 WP_003898819.1.17722 WP_003898819.1.17746 WP_003898819.1.17788 WP_003898819.1.17798 WP_003898819.1.17803 WP_003898819.1.17816 WP_003898819.1.17821 WP_003898819.1.17830 WP_003898819.1.17868 WP_003898819.1.17878 WP_003898819.1.1792 WP_003898819.1.17923 WP_003898819.1.1795 WP_003898819.1.17955 WP_003898819.1.17973 WP_003898819.1.18009 WP_003898819.1.18013 WP_003898819.1.18033 WP_003898819.1.18057 WP_003898819.1.18065 WP_003898819.1.18070 WP_003898819.1.18116 WP_003898819.1.18120 WP_003898819.1.18126 WP_003898819.1.1817 WP_003898819.1.18170 WP_003898819.1.18206 WP_003898819.1.18216 WP_003898819.1.18240 WP_003898819.1.18297 WP_003898819.1.18306 WP_003898819.1.18364 WP_003898819.1.18399 WP_003898819.1.18411 WP_003898819.1.18444 WP_003898819.1.18467 WP_003898819.1.18476 WP_003898819.1.18522 WP_003898819.1.18580 WP_003898819.1.18582 WP_003898819.1.18587 WP_003898819.1.186 WP_003898819.1.18601 WP_003898819.1.18639 WP_003898819.1.18646 WP_003898819.1.18647 WP_003898819.1.1868 WP_003898819.1.18694 WP_003898819.1.18710 WP_003898819.1.18751 WP_003898819.1.18781 WP_003898819.1.18793 WP_003898819.1.18804 WP_003898819.1.18816 WP_003898819.1.18823 WP_003898819.1.18827 WP_003898819.1.18838 WP_003898819.1.18849 WP_003898819.1.18856 WP_003898819.1.18945 WP_003898819.1.1898 WP_003898819.1.19005 WP_003898819.1.19056 WP_003898819.1.19063 WP_003898819.1.19066 WP_003898819.1.19071 WP_003898819.1.19085 WP_003898819.1.19094 WP_003898819.1.19144 WP_003898819.1.19159 WP_003898819.1.19231 WP_003898819.1.19243 WP_003898819.1.19264 WP_003898819.1.19295 WP_003898819.1.19307 WP_003898819.1.19326 WP_003898819.1.1933 WP_003898819.1.19364 WP_003898819.1.19382 WP_003898819.1.19400 WP_003898819.1.19426 WP_003898819.1.19429 WP_003898819.1.19480 WP_003898819.1.19512 WP_003898819.1.19553 WP_003898819.1.19562 WP_003898819.1.19564 WP_003898819.1.19568 WP_003898819.1.19572 WP_003898819.1.19595 WP_003898819.1.19596 WP_003898819.1.19600 WP_003898819.1.19630 WP_003898819.1.1967 WP_003898819.1.19694 WP_003898819.1.1970 WP_003898819.1.19707 WP_003898819.1.19742 WP_003898819.1.19785 WP_003898819.1.19820 WP_003898819.1.19868 WP_003898819.1.19874 WP_003898819.1.19890 WP_003898819.1.19900 WP_003898819.1.19922 WP_003898819.1.19936 WP_003898819.1.19946 WP_003898819.1.19949 WP_003898819.1.19960 WP_003898819.1.19964 WP_003898819.1.20007 WP_003898819.1.20016 WP_003898819.1.20028 WP_003898819.1.2003 WP_003898819.1.20037 WP_003898819.1.20039 WP_003898819.1.20082 WP_003898819.1.20085 WP_003898819.1.20097 WP_003898819.1.20116 WP_003898819.1.20130 WP_003898819.1.20141 WP_003898819.1.20142 WP_003898819.1.20158 WP_003898819.1.20239 WP_003898819.1.20243 WP_003898819.1.20259 WP_003898819.1.20262 WP_003898819.1.20272 WP_003898819.1.20273 WP_003898819.1.20280 WP_003898819.1.20294 WP_003898819.1.20300 WP_003898819.1.20309 WP_003898819.1.20322 WP_003898819.1.2037 WP_003898819.1.20372 WP_003898819.1.20381 WP_003898819.1.204 WP_003898819.1.20427 WP_003898819.1.20432 WP_003898819.1.20457 WP_003898819.1.20459 WP_003898819.1.20460 WP_003898819.1.20542 WP_003898819.1.20578 WP_003898819.1.20608 WP_003898819.1.20624 WP_003898819.1.20628 WP_003898819.1.2066 WP_003898819.1.20707 WP_003898819.1.20722 WP_003898819.1.20729 WP_003898819.1.20742 WP_003898819.1.20751 WP_003898819.1.20776 WP_003898819.1.20843 WP_003898819.1.20850 WP_003898819.1.2086 WP_003898819.1.20868 WP_003898819.1.20876 WP_003898819.1.20897 WP_003898819.1.2090 WP_003898819.1.20911 WP_003898819.1.20916 WP_003898819.1.20921 WP_003898819.1.20926 WP_003898819.1.20927 WP_003898819.1.20951 WP_003898819.1.20970 WP_003898819.1.2104 WP_003898819.1.21070 WP_003898819.1.21127 WP_003898819.1.21135 WP_003898819.1.21173 WP_003898819.1.21187 WP_003898819.1.212 WP_003898819.1.2120 WP_003898819.1.21218 WP_003898819.1.21219 WP_003898819.1.2123 WP_003898819.1.21231 WP_003898819.1.21234 WP_003898819.1.2126 WP_003898819.1.21292 WP_003898819.1.21307 WP_003898819.1.2131 WP_003898819.1.21311 WP_003898819.1.21321 WP_003898819.1.21365 WP_003898819.1.2137 WP_003898819.1.21392 WP_003898819.1.21397 WP_003898819.1.21403 WP_003898819.1.21415 WP_003898819.1.21418 WP_003898819.1.21430 WP_003898819.1.21434 WP_003898819.1.21444 WP_003898819.1.21468 WP_003898819.1.21498 WP_003898819.1.21509 WP_003898819.1.21513 WP_003898819.1.21560 WP_003898819.1.21565 WP_003898819.1.21586 WP_003898819.1.21591 WP_003898819.1.21594 WP_003898819.1.21602 WP_003898819.1.21615 WP_003898819.1.21638 WP_003898819.1.21639 WP_003898819.1.21655 WP_003898819.1.21658 WP_003898819.1.2168 WP_003898819.1.2174 WP_003898819.1.21741 WP_003898819.1.21742 WP_003898819.1.21777 WP_003898819.1.21786 WP_003898819.1.21795 WP_003898819.1.218 WP_003898819.1.21826 WP_003898819.1.21829 WP_003898819.1.21840 WP_003898819.1.21843 WP_003898819.1.21872 WP_003898819.1.2188 WP_003898819.1.21882 WP_003898819.1.21906 WP_003898819.1.21912 WP_003898819.1.2194 WP_003898819.1.21941 WP_003898819.1.21956 WP_003898819.1.21958 WP_003898819.1.21960 WP_003898819.1.21971 WP_003898819.1.21973 WP_003898819.1.21983 WP_003898819.1.22003 WP_003898819.1.22013 WP_003898819.1.22025 WP_003898819.1.22036 WP_003898819.1.22075 WP_003898819.1.22092 WP_003898819.1.2212 WP_003898819.1.22127 WP_003898819.1.22140 WP_003898819.1.22233 WP_003898819.1.22255 WP_003898819.1.22277 WP_003898819.1.22305 WP_003898819.1.22348 WP_003898819.1.22366 WP_003898819.1.2238 WP_003898819.1.22380 WP_003898819.1.22437 WP_003898819.1.22438 WP_003898819.1.22445 WP_003898819.1.22490 WP_003898819.1.22511 WP_003898819.1.22524 WP_003898819.1.2253 WP_003898819.1.22585 WP_003898819.1.22589 WP_003898819.1.22606 WP_003898819.1.22608 WP_003898819.1.22609 WP_003898819.1.22618 WP_003898819.1.2262 WP_003898819.1.22624 WP_003898819.1.22629 WP_003898819.1.22647 WP_003898819.1.22664 WP_003898819.1.22670 WP_003898819.1.22674 WP_003898819.1.22680 WP_003898819.1.22725 WP_003898819.1.22728 WP_003898819.1.22733 WP_003898819.1.22737 WP_003898819.1.2275 WP_003898819.1.22754 WP_003898819.1.22797 WP_003898819.1.22800 WP_003898819.1.22804 WP_003898819.1.22829 WP_003898819.1.22840 WP_003898819.1.22844 WP_003898819.1.22970 WP_003898819.1.22996 WP_003898819.1.22997 WP_003898819.1.22999 WP_003898819.1.23015 WP_003898819.1.23032 WP_003898819.1.231 WP_003898819.1.23101 WP_003898819.1.2312 WP_003898819.1.23140 WP_003898819.1.23153 WP_003898819.1.23171 WP_003898819.1.23199 WP_003898819.1.2320 WP_003898819.1.23204 WP_003898819.1.23216 WP_003898819.1.23229 WP_003898819.1.23233 WP_003898819.1.2326 WP_003898819.1.23261 WP_003898819.1.23289 WP_003898819.1.2329 WP_003898819.1.23308 WP_003898819.1.23316 WP_003898819.1.23321 WP_003898819.1.23325 WP_003898819.1.2339 WP_003898819.1.23406 WP_003898819.1.23438 WP_003898819.1.23445 WP_003898819.1.23447 WP_003898819.1.23452 WP_003898819.1.23461 WP_003898819.1.2349 WP_003898819.1.23496 WP_003898819.1.23497 WP_003898819.1.23506 WP_003898819.1.23530 WP_003898819.1.23539 WP_003898819.1.23546 WP_003898819.1.23551 WP_003898819.1.23573 WP_003898819.1.23583 WP_003898819.1.23588 WP_003898819.1.23628 WP_003898819.1.23677 WP_003898819.1.23683 WP_003898819.1.23692 WP_003898819.1.23694 WP_003898819.1.23699 WP_003898819.1.2371 WP_003898819.1.23803 WP_003898819.1.23807 WP_003898819.1.23825 WP_003898819.1.23832 WP_003898819.1.2384 WP_003898819.1.23843 WP_003898819.1.23894 WP_003898819.1.23993 WP_003898819.1.2400 WP_003898819.1.24007 WP_003898819.1.24008 WP_003898819.1.24046 WP_003898819.1.24057 WP_003898819.1.24062 WP_003898819.1.24113 WP_003898819.1.24119 WP_003898819.1.24128 WP_003898819.1.24140 WP_003898819.1.24176 WP_003898819.1.24190 WP_003898819.1.24202 WP_003898819.1.24244 WP_003898819.1.24261 WP_003898819.1.24284 WP_003898819.1.24294 WP_003898819.1.24357 WP_003898819.1.24396 WP_003898819.1.24414 WP_003898819.1.24423 WP_003898819.1.2443 WP_003898819.1.24446 WP_003898819.1.24461 WP_003898819.1.24500 WP_003898819.1.24507 WP_003898819.1.24509 WP_003898819.1.24529 WP_003898819.1.24553 WP_003898819.1.24599 WP_003898819.1.24629 WP_003898819.1.24638 WP_003898819.1.24648 WP_003898819.1.2466 WP_003898819.1.24767 WP_003898819.1.24824 WP_003898819.1.24831 WP_003898819.1.24840 WP_003898819.1.24848 WP_003898819.1.24857 WP_003898819.1.2487 WP_003898819.1.24893 WP_003898819.1.24907 WP_003898819.1.24933 WP_003898819.1.24956 WP_003898819.1.24958 WP_003898819.1.24985 WP_003898819.1.2499 WP_003898819.1.25004 WP_003898819.1.2505 WP_003898819.1.25051 WP_003898819.1.2507 WP_003898819.1.25096 WP_003898819.1.25103 WP_003898819.1.25129 WP_003898819.1.25171 WP_003898819.1.25247 WP_003898819.1.25252 WP_003898819.1.25278 WP_003898819.1.25283 WP_003898819.1.25309 WP_003898819.1.25313 WP_003898819.1.25338 WP_003898819.1.25342 WP_003898819.1.25343 WP_003898819.1.25367 WP_003898819.1.25393 WP_003898819.1.25406 WP_003898819.1.25435 WP_003898819.1.25437 WP_003898819.1.25445 WP_003898819.1.25455 WP_003898819.1.25473 WP_003898819.1.25504 WP_003898819.1.25513 WP_003898819.1.25542 WP_003898819.1.25579 WP_003898819.1.25594 WP_003898819.1.25606 WP_003898819.1.25645 WP_003898819.1.2566 WP_003898819.1.25673 WP_003898819.1.25674 WP_003898819.1.25693 WP_003898819.1.25699 WP_003898819.1.25727 WP_003898819.1.25736 WP_003898819.1.25738 WP_003898819.1.25756 WP_003898819.1.25759 WP_003898819.1.2580 WP_003898819.1.25813 WP_003898819.1.25853 WP_003898819.1.25854 WP_003898819.1.25874 WP_003898819.1.25885 WP_003898819.1.25892 WP_003898819.1.25906 WP_003898819.1.25914 WP_003898819.1.2594 WP_003898819.1.25954 WP_003898819.1.25965 WP_003898819.1.25972 WP_003898819.1.26017 WP_003898819.1.26032 WP_003898819.1.26038 WP_003898819.1.26072 WP_003898819.1.26089 WP_003898819.1.26097 WP_003898819.1.26098 WP_003898819.1.26108 WP_003898819.1.26109 WP_003898819.1.26118 WP_003898819.1.26126 WP_003898819.1.2614 WP_003898819.1.26168 WP_003898819.1.26182 WP_003898819.1.26190 WP_003898819.1.2620 WP_003898819.1.26234 WP_003898819.1.26243 WP_003898819.1.26265 WP_003898819.1.26267 WP_003898819.1.26292 WP_003898819.1.26310 WP_003898819.1.26328 WP_003898819.1.26349 WP_003898819.1.26366 WP_003898819.1.26374 WP_003898819.1.26407 WP_003898819.1.26412 WP_003898819.1.26454 WP_003898819.1.26464 WP_003898819.1.2653 WP_003898819.1.26560 WP_003898819.1.26571 WP_003898819.1.2659 WP_003898819.1.26597 WP_003898819.1.26603 WP_003898819.1.26629 WP_003898819.1.26651 WP_003898819.1.26702 WP_003898819.1.26707 WP_003898819.1.26710 WP_003898819.1.26719 WP_003898819.1.26737 WP_003898819.1.26738 WP_003898819.1.26745 WP_003898819.1.26756 WP_003898819.1.2676 WP_003898819.1.2677 WP_003898819.1.26779 WP_003898819.1.26780 WP_003898819.1.26798 WP_003898819.1.26854 WP_003898819.1.26868 WP_003898819.1.26876 WP_003898819.1.26888 WP_003898819.1.26914 WP_003898819.1.26945 WP_003898819.1.26959 WP_003898819.1.26969 WP_003898819.1.26984 WP_003898819.1.27004 WP_003898819.1.27017 WP_003898819.1.27045 WP_003898819.1.27074 WP_003898819.1.27075 WP_003898819.1.27128 WP_003898819.1.27130 WP_003898819.1.27139 WP_003898819.1.27152 WP_003898819.1.27162 WP_003898819.1.27193 WP_003898819.1.27235 WP_003898819.1.27254 WP_003898819.1.27278 WP_003898819.1.27343 WP_003898819.1.27352 WP_003898819.1.27369 WP_003898819.1.27391 WP_003898819.1.27398 WP_003898819.1.27402 WP_003898819.1.27410 WP_003898819.1.27411 WP_003898819.1.27449 WP_003898819.1.27460 WP_003898819.1.27463 WP_003898819.1.2749 WP_003898819.1.27492 WP_003898819.1.27528 WP_003898819.1.27541 WP_003898819.1.27576 WP_003898819.1.27582 WP_003898819.1.27596 WP_003898819.1.27607 WP_003898819.1.2766 WP_003898819.1.277 WP_003898819.1.27724 WP_003898819.1.27730 WP_003898819.1.27736 WP_003898819.1.27743 WP_003898819.1.27750 WP_003898819.1.27771 WP_003898819.1.27779 WP_003898819.1.27795 WP_003898819.1.27803 WP_003898819.1.27819 WP_003898819.1.27915 WP_003898819.1.27935 WP_003898819.1.27962 WP_003898819.1.28053 WP_003898819.1.28092 WP_003898819.1.28106 WP_003898819.1.28131 WP_003898819.1.28142 WP_003898819.1.28159 WP_003898819.1.2816 WP_003898819.1.28161 WP_003898819.1.28192 WP_003898819.1.28202 WP_003898819.1.28241 WP_003898819.1.28242 WP_003898819.1.28251 WP_003898819.1.28269 WP_003898819.1.28276 WP_003898819.1.28293 WP_003898819.1.28331 WP_003898819.1.28367 WP_003898819.1.28391 WP_003898819.1.2842 WP_003898819.1.28448 WP_003898819.1.28471 WP_003898819.1.28473 WP_003898819.1.28493 WP_003898819.1.28497 WP_003898819.1.28530 WP_003898819.1.28545 WP_003898819.1.28561 WP_003898819.1.28567 WP_003898819.1.28585 WP_003898819.1.286 WP_003898819.1.28610 WP_003898819.1.28617 WP_003898819.1.28634 WP_003898819.1.28642 WP_003898819.1.28671 WP_003898819.1.28682 WP_003898819.1.28698 WP_003898819.1.28703 WP_003898819.1.28739 WP_003898819.1.28758 WP_003898819.1.28781 WP_003898819.1.28787 WP_003898819.1.28827 WP_003898819.1.28839 WP_003898819.1.28847 WP_003898819.1.28850 WP_003898819.1.28851 WP_003898819.1.28865 WP_003898819.1.28897 WP_003898819.1.28914 WP_003898819.1.28935 WP_003898819.1.28936 WP_003898819.1.28939 WP_003898819.1.28943 WP_003898819.1.28952 WP_003898819.1.28975 WP_003898819.1.2899 WP_003898819.1.28993 WP_003898819.1.29000 WP_003898819.1.2901 WP_003898819.1.29028 WP_003898819.1.29033 WP_003898819.1.29058 WP_003898819.1.29078 WP_003898819.1.29102 WP_003898819.1.29115 WP_003898819.1.2916 WP_003898819.1.29217 WP_003898819.1.29223 WP_003898819.1.29234 WP_003898819.1.29264 WP_003898819.1.29275 WP_003898819.1.29306 WP_003898819.1.29339 WP_003898819.1.29364 WP_003898819.1.29367 WP_003898819.1.2938 WP_003898819.1.29399 WP_003898819.1.29426 WP_003898819.1.2944 WP_003898819.1.29449 WP_003898819.1.29450 WP_003898819.1.29452 WP_003898819.1.2949 WP_003898819.1.29510 WP_003898819.1.29515 WP_003898819.1.29525 WP_003898819.1.2953 WP_003898819.1.29559 WP_003898819.1.29587 WP_003898819.1.2959 WP_003898819.1.29592 WP_003898819.1.29599 WP_003898819.1.29611 WP_003898819.1.29632 WP_003898819.1.29649 WP_003898819.1.2965 WP_003898819.1.29659 WP_003898819.1.2969 WP_003898819.1.29696 WP_003898819.1.29698 WP_003898819.1.29718 WP_003898819.1.29742 WP_003898819.1.29745 WP_003898819.1.29747 WP_003898819.1.29769 WP_003898819.1.29825 WP_003898819.1.29830 WP_003898819.1.29847 WP_003898819.1.29861 WP_003898819.1.29869 WP_003898819.1.29883 WP_003898819.1.29890 WP_003898819.1.29931 WP_003898819.1.29960 WP_003898819.1.30014 WP_003898819.1.3004 WP_003898819.1.30040 WP_003898819.1.30074 WP_003898819.1.30097 WP_003898819.1.30106 WP_003898819.1.30114 WP_003898819.1.30126 WP_003898819.1.30131 WP_003898819.1.30138 WP_003898819.1.30139 WP_003898819.1.30145 WP_003898819.1.30211 WP_003898819.1.30224 WP_003898819.1.30235 WP_003898819.1.3027 WP_003898819.1.30279 WP_003898819.1.30282 WP_003898819.1.30283 WP_003898819.1.30288 WP_003898819.1.30291 WP_003898819.1.30363 WP_003898819.1.30374 WP_003898819.1.30404 WP_003898819.1.3043 WP_003898819.1.30433 WP_003898819.1.30438 WP_003898819.1.30462 WP_003898819.1.30464 WP_003898819.1.30468 WP_003898819.1.30500 WP_003898819.1.3057 WP_003898819.1.30574 WP_003898819.1.30628 WP_003898819.1.30642 WP_003898819.1.30661 WP_003898819.1.30669 WP_003898819.1.30683 WP_003898819.1.30699 WP_003898819.1.30709 WP_003898819.1.30713 WP_003898819.1.30716 WP_003898819.1.30719 WP_003898819.1.30730 WP_003898819.1.30732 WP_003898819.1.30736 WP_003898819.1.30745 WP_003898819.1.30760 WP_003898819.1.30791 WP_003898819.1.308 WP_003898819.1.30807 WP_003898819.1.30818 WP_003898819.1.30824 WP_003898819.1.30848 WP_003898819.1.30877 WP_003898819.1.30888 WP_003898819.1.30901 WP_003898819.1.30903 WP_003898819.1.30912 WP_003898819.1.30913 WP_003898819.1.30914 WP_003898819.1.30919 WP_003898819.1.30977 WP_003898819.1.3100 WP_003898819.1.31002 WP_003898819.1.3101 WP_003898819.1.31034 WP_003898819.1.31047 WP_003898819.1.31070 WP_003898819.1.31074 WP_003898819.1.31102 WP_003898819.1.31127 WP_003898819.1.31184 WP_003898819.1.31199 WP_003898819.1.31226 WP_003898819.1.31233 WP_003898819.1.31263 WP_003898819.1.31264 WP_003898819.1.31270 WP_003898819.1.31287 WP_003898819.1.31290 WP_003898819.1.31304 WP_003898819.1.31346 WP_003898819.1.31348 WP_003898819.1.31354 WP_003898819.1.31390 WP_003898819.1.31414 WP_003898819.1.31417 WP_003898819.1.3143 WP_003898819.1.31458 WP_003898819.1.31483 WP_003898819.1.3149 WP_003898819.1.31498 WP_003898819.1.31507 WP_003898819.1.31537 WP_003898819.1.31548 WP_003898819.1.316 WP_003898819.1.31629 WP_003898819.1.31666 WP_003898819.1.31693 WP_003898819.1.31703 WP_003898819.1.31744 WP_003898819.1.31770 WP_003898819.1.31776 WP_003898819.1.31783 WP_003898819.1.318 WP_003898819.1.3184 WP_003898819.1.31840 WP_003898819.1.31880 WP_003898819.1.31911 WP_003898819.1.31930 WP_003898819.1.31932 WP_003898819.1.31955 WP_003898819.1.31985 WP_003898819.1.31991 WP_003898819.1.31995 WP_003898819.1.32004 WP_003898819.1.32039 WP_003898819.1.3204 WP_003898819.1.32045 WP_003898819.1.32071 WP_003898819.1.32098 WP_003898819.1.32157 WP_003898819.1.32164 WP_003898819.1.32179 WP_003898819.1.32198 WP_003898819.1.32297 WP_003898819.1.32317 WP_003898819.1.32383 WP_003898819.1.32400 WP_003898819.1.32403 WP_003898819.1.32416 WP_003898819.1.32421 WP_003898819.1.32433 WP_003898819.1.32461 WP_003898819.1.32482 WP_003898819.1.32503 WP_003898819.1.32556 WP_003898819.1.32562 WP_003898819.1.32569 WP_003898819.1.32592 WP_003898819.1.32620 WP_003898819.1.32647 WP_003898819.1.32653 WP_003898819.1.32654 WP_003898819.1.3268 WP_003898819.1.32695 WP_003898819.1.32706 WP_003898819.1.32716 WP_003898819.1.32738 WP_003898819.1.32752 WP_003898819.1.32780 WP_003898819.1.32781 WP_003898819.1.32793 WP_003898819.1.32799 WP_003898819.1.32822 WP_003898819.1.32833 WP_003898819.1.32862 WP_003898819.1.32880 WP_003898819.1.32897 WP_003898819.1.32909 WP_003898819.1.32935 WP_003898819.1.32974 WP_003898819.1.33007 WP_003898819.1.3302 WP_003898819.1.33028 WP_003898819.1.33035 WP_003898819.1.33044 WP_003898819.1.33054 WP_003898819.1.33082 WP_003898819.1.33141 WP_003898819.1.33148 WP_003898819.1.33155 WP_003898819.1.3321 WP_003898819.1.33215 WP_003898819.1.3325 WP_003898819.1.3327 WP_003898819.1.33278 WP_003898819.1.33288 WP_003898819.1.33305 WP_003898819.1.3331 WP_003898819.1.33319 WP_003898819.1.3333 WP_003898819.1.33393 WP_003898819.1.33403 WP_003898819.1.33452 WP_003898819.1.33467 WP_003898819.1.33477 WP_003898819.1.3349 WP_003898819.1.33519 WP_003898819.1.33542 WP_003898819.1.33601 WP_003898819.1.33602 WP_003898819.1.33633 WP_003898819.1.33646 WP_003898819.1.33673 WP_003898819.1.3369 WP_003898819.1.33705 WP_003898819.1.33762 WP_003898819.1.33783 WP_003898819.1.33789 WP_003898819.1.3383 WP_003898819.1.33832 WP_003898819.1.33839 WP_003898819.1.33848 WP_003898819.1.3387 WP_003898819.1.33886 WP_003898819.1.33895 WP_003898819.1.33906 WP_003898819.1.33912 WP_003898819.1.33954 WP_003898819.1.3399 WP_003898819.1.34042 WP_003898819.1.3405 WP_003898819.1.34055 WP_003898819.1.34056 WP_003898819.1.34065 WP_003898819.1.3408 WP_003898819.1.34090 WP_003898819.1.34109 WP_003898819.1.34111 WP_003898819.1.34131 WP_003898819.1.34152 WP_003898819.1.34153 WP_003898819.1.34163 WP_003898819.1.34181 WP_003898819.1.34197 WP_003898819.1.34198 WP_003898819.1.34215 WP_003898819.1.34219 WP_003898819.1.34255 WP_003898819.1.34260 WP_003898819.1.34275 WP_003898819.1.343 WP_003898819.1.34347 WP_003898819.1.34358 WP_003898819.1.34392 WP_003898819.1.344 WP_003898819.1.34428 WP_003898819.1.3443 WP_003898819.1.34435 WP_003898819.1.34446 WP_003898819.1.34499 WP_003898819.1.34505 WP_003898819.1.34516 WP_003898819.1.34529 WP_003898819.1.34551 WP_003898819.1.34563 WP_003898819.1.34576 WP_003898819.1.34581 WP_003898819.1.34588 WP_003898819.1.34596 WP_003898819.1.34599 WP_003898819.1.34639 WP_003898819.1.34673 WP_003898819.1.34724 WP_003898819.1.34740 WP_003898819.1.34755 WP_003898819.1.34777 WP_003898819.1.34783 WP_003898819.1.34841 WP_003898819.1.34908 WP_003898819.1.34919 WP_003898819.1.3492 WP_003898819.1.34933 WP_003898819.1.34945 WP_003898819.1.34946 WP_003898819.1.34954 WP_003898819.1.34960 WP_003898819.1.34961 WP_003898819.1.34963 WP_003898819.1.34965 WP_003898819.1.34968 WP_003898819.1.35023 WP_003898819.1.35069 WP_003898819.1.35072 WP_003898819.1.35078 WP_003898819.1.35100 WP_003898819.1.35146 WP_003898819.1.35156 WP_003898819.1.35160 WP_003898819.1.35162 WP_003898819.1.35173 WP_003898819.1.35176 WP_003898819.1.3520 WP_003898819.1.35213 WP_003898819.1.35221 WP_003898819.1.35246 WP_003898819.1.35278 WP_003898819.1.35301 WP_003898819.1.35311 WP_003898819.1.35312 WP_003898819.1.35317 WP_003898819.1.35319 WP_003898819.1.35347 WP_003898819.1.35363 WP_003898819.1.35382 WP_003898819.1.35385 WP_003898819.1.35396 WP_003898819.1.35397 WP_003898819.1.35426 WP_003898819.1.35439 WP_003898819.1.35455 WP_003898819.1.3548 WP_003898819.1.35484 WP_003898819.1.35492 WP_003898819.1.3553 WP_003898819.1.35553 WP_003898819.1.35555 WP_003898819.1.35561 WP_003898819.1.35602 WP_003898819.1.35610 WP_003898819.1.35635 WP_003898819.1.35657 WP_003898819.1.35680 WP_003898819.1.35687 WP_003898819.1.35689 WP_003898819.1.35707 WP_003898819.1.35732 WP_003898819.1.35754 WP_003898819.1.35767 WP_003898819.1.35770 WP_003898819.1.35780 WP_003898819.1.35805 WP_003898819.1.35811 WP_003898819.1.35821 WP_003898819.1.3584 WP_003898819.1.35848 WP_003898819.1.35864 WP_003898819.1.35874 WP_003898819.1.35876 WP_003898819.1.35897 WP_003898819.1.35899 WP_003898819.1.35923 WP_003898819.1.35954 WP_003898819.1.36005 WP_003898819.1.36014 WP_003898819.1.36023 WP_003898819.1.36051 WP_003898819.1.36053 WP_003898819.1.36075 WP_003898819.1.36089 WP_003898819.1.36097 WP_003898819.1.36098 WP_003898819.1.36116 WP_003898819.1.36145 WP_003898819.1.36156 WP_003898819.1.36205 WP_003898819.1.36228 WP_003898819.1.36246 WP_003898819.1.36252 WP_003898819.1.36260 WP_003898819.1.36270 WP_003898819.1.36271 WP_003898819.1.36303 WP_003898819.1.36309 WP_003898819.1.36315 WP_003898819.1.36319 WP_003898819.1.36326 WP_003898819.1.3634 WP_003898819.1.36356 WP_003898819.1.36357 WP_003898819.1.3636 WP_003898819.1.36385 WP_003898819.1.36399 WP_003898819.1.36436 WP_003898819.1.36465 WP_003898819.1.36469 WP_003898819.1.36473 WP_003898819.1.36485 WP_003898819.1.36508 WP_003898819.1.36540 WP_003898819.1.36561 WP_003898819.1.36571 WP_003898819.1.36573 WP_003898819.1.36578 WP_003898819.1.36585 WP_003898819.1.36597 WP_003898819.1.36614 WP_003898819.1.36657 WP_003898819.1.36674 WP_003898819.1.36720 WP_003898819.1.36727 WP_003898819.1.36733 WP_003898819.1.36785 WP_003898819.1.36810 WP_003898819.1.36844 WP_003898819.1.36851 WP_003898819.1.36862 WP_003898819.1.36893 WP_003898819.1.36921 WP_003898819.1.36935 WP_003898819.1.36941 WP_003898819.1.3695 WP_003898819.1.36951 WP_003898819.1.36968 WP_003898819.1.3700 WP_003898819.1.37004 WP_003898819.1.37012 WP_003898819.1.37071 WP_003898819.1.37088 WP_003898819.1.37131 WP_003898819.1.37157 WP_003898819.1.37175 WP_003898819.1.37188 WP_003898819.1.37213 WP_003898819.1.37229 WP_003898819.1.3724 WP_003898819.1.37277 WP_003898819.1.37305 WP_003898819.1.37330 WP_003898819.1.37389 WP_003898819.1.37400 WP_003898819.1.37440 WP_003898819.1.37459 WP_003898819.1.37468 WP_003898819.1.37475 WP_003898819.1.37484 WP_003898819.1.37601 WP_003898819.1.37612 WP_003898819.1.37632 WP_003898819.1.37655 WP_003898819.1.37660 WP_003898819.1.37674 WP_003898819.1.37700 WP_003898819.1.37701 WP_003898819.1.37709 WP_003898819.1.37711 WP_003898819.1.37721 WP_003898819.1.37722 WP_003898819.1.37747 WP_003898819.1.37765 WP_003898819.1.37772 WP_003898819.1.37804 WP_003898819.1.37809 WP_003898819.1.37859 WP_003898819.1.37877 WP_003898819.1.37912 WP_003898819.1.37913 WP_003898819.1.37943 WP_003898819.1.37950 WP_003898819.1.37973 WP_003898819.1.37975 WP_003898819.1.37983 WP_003898819.1.38 WP_003898819.1.38002 WP_003898819.1.3802 WP_003898819.1.38039 WP_003898819.1.38040 WP_003898819.1.38067 WP_003898819.1.38068 WP_003898819.1.38135 WP_003898819.1.38138 WP_003898819.1.38144 WP_003898819.1.38158 WP_003898819.1.38159 WP_003898819.1.38210 WP_003898819.1.38233 WP_003898819.1.38240 WP_003898819.1.38299 WP_003898819.1.38332 WP_003898819.1.38347 WP_003898819.1.38354 WP_003898819.1.38380 WP_003898819.1.38384 WP_003898819.1.38389 WP_003898819.1.38398 WP_003898819.1.38402 WP_003898819.1.38418 WP_003898819.1.38421 WP_003898819.1.38466 WP_003898819.1.38477 WP_003898819.1.38483 WP_003898819.1.3849 WP_003898819.1.385 WP_003898819.1.38530 WP_003898819.1.38535 WP_003898819.1.38539 WP_003898819.1.38594 WP_003898819.1.38601 WP_003898819.1.38611 WP_003898819.1.38638 WP_003898819.1.38639 WP_003898819.1.38646 WP_003898819.1.38648 WP_003898819.1.38654 WP_003898819.1.38659 WP_003898819.1.38660 WP_003898819.1.38666 WP_003898819.1.38671 WP_003898819.1.38672 WP_003898819.1.38750 WP_003898819.1.38772 WP_003898819.1.38812 WP_003898819.1.38821 WP_003898819.1.38844 WP_003898819.1.38863 WP_003898819.1.38873 WP_003898819.1.3889 WP_003898819.1.38894 WP_003898819.1.38909 WP_003898819.1.38939 WP_003898819.1.38974 WP_003898819.1.38975 WP_003898819.1.38991 WP_003898819.1.39025 WP_003898819.1.39070 WP_003898819.1.39072 WP_003898819.1.39095 WP_003898819.1.39106 WP_003898819.1.39165 WP_003898819.1.39174 WP_003898819.1.39176 WP_003898819.1.39178 WP_003898819.1.39190 WP_003898819.1.39201 WP_003898819.1.39207 WP_003898819.1.39211 WP_003898819.1.39236 WP_003898819.1.39239 WP_003898819.1.39252 WP_003898819.1.39288 WP_003898819.1.39295 WP_003898819.1.39359 WP_003898819.1.39364 WP_003898819.1.39400 WP_003898819.1.39447 WP_003898819.1.3945 WP_003898819.1.39450 WP_003898819.1.39455 WP_003898819.1.3949 WP_003898819.1.39521 WP_003898819.1.39560 WP_003898819.1.39592 WP_003898819.1.39593 WP_003898819.1.396 WP_003898819.1.3960 WP_003898819.1.39616 WP_003898819.1.39654 WP_003898819.1.39657 WP_003898819.1.39661 WP_003898819.1.39674 WP_003898819.1.39678 WP_003898819.1.3968 WP_003898819.1.39694 WP_003898819.1.3971 WP_003898819.1.39728 WP_003898819.1.39739 WP_003898819.1.39748 WP_003898819.1.39751 WP_003898819.1.39759 WP_003898819.1.39801 WP_003898819.1.39804 WP_003898819.1.39848 WP_003898819.1.39877 WP_003898819.1.39925 WP_003898819.1.3994 WP_003898819.1.39959 WP_003898819.1.3996 WP_003898819.1.39960 WP_003898819.1.3997 WP_003898819.1.39980 WP_003898819.1.40000 WP_003898819.1.40028 WP_003898819.1.40029 WP_003898819.1.4003 WP_003898819.1.40096 WP_003898819.1.40156 WP_003898819.1.40174 WP_003898819.1.40186 WP_003898819.1.40276 WP_003898819.1.40277 WP_003898819.1.40323 WP_003898819.1.40336 WP_003898819.1.40353 WP_003898819.1.4036 WP_003898819.1.40372 WP_003898819.1.40402 WP_003898819.1.40413 WP_003898819.1.40440 WP_003898819.1.40446 WP_003898819.1.40451 WP_003898819.1.40455 WP_003898819.1.40523 WP_003898819.1.40543 WP_003898819.1.40641 WP_003898819.1.40646 WP_003898819.1.40651 WP_003898819.1.40653 WP_003898819.1.4067 WP_003898819.1.40705 WP_003898819.1.40723 WP_003898819.1.40731 WP_003898819.1.40735 WP_003898819.1.40795 WP_003898819.1.40799 WP_003898819.1.40852 WP_003898819.1.40876 WP_003898819.1.40881 WP_003898819.1.40922 WP_003898819.1.40948 WP_003898819.1.4095 WP_003898819.1.40956 WP_003898819.1.40957 WP_003898819.1.40964 WP_003898819.1.4097 WP_003898819.1.410 WP_003898819.1.41000 WP_003898819.1.41055 WP_003898819.1.41108 WP_003898819.1.41123 WP_003898819.1.41177 WP_003898819.1.41202 WP_003898819.1.41219 WP_003898819.1.41231 WP_003898819.1.41249 WP_003898819.1.4127 WP_003898819.1.41296 WP_003898819.1.41355 WP_003898819.1.41376 WP_003898819.1.41430 WP_003898819.1.41447 WP_003898819.1.41469 WP_003898819.1.41504 WP_003898819.1.41553 WP_003898819.1.41564 WP_003898819.1.41583 WP_003898819.1.41616 WP_003898819.1.41632 WP_003898819.1.41635 WP_003898819.1.41648 WP_003898819.1.41660 WP_003898819.1.41685 WP_003898819.1.41695 WP_003898819.1.41704 WP_003898819.1.4171 WP_003898819.1.41719 WP_003898819.1.41733 WP_003898819.1.41744 WP_003898819.1.41774 WP_003898819.1.41791 WP_003898819.1.41803 WP_003898819.1.41820 WP_003898819.1.41828 WP_003898819.1.41829 WP_003898819.1.41860 WP_003898819.1.41912 WP_003898819.1.41921 WP_003898819.1.41933 WP_003898819.1.41944 WP_003898819.1.42043 WP_003898819.1.42075 WP_003898819.1.42078 WP_003898819.1.42094 WP_003898819.1.42112 WP_003898819.1.4212 WP_003898819.1.42122 WP_003898819.1.42134 WP_003898819.1.42183 WP_003898819.1.42188 WP_003898819.1.42201 WP_003898819.1.42202 WP_003898819.1.42208 WP_003898819.1.42247 WP_003898819.1.42255 WP_003898819.1.42273 WP_003898819.1.42278 WP_003898819.1.42304 WP_003898819.1.42309 WP_003898819.1.42370 WP_003898819.1.42385 WP_003898819.1.42400 WP_003898819.1.42409 WP_003898819.1.42414 WP_003898819.1.42417 WP_003898819.1.42430 WP_003898819.1.42461 WP_003898819.1.42465 WP_003898819.1.42467 WP_003898819.1.42473 WP_003898819.1.4248 WP_003898819.1.42494 WP_003898819.1.42519 WP_003898819.1.42524 WP_003898819.1.42534 WP_003898819.1.4255 WP_003898819.1.42562 WP_003898819.1.42568 WP_003898819.1.42570 WP_003898819.1.42618 WP_003898819.1.42660 WP_003898819.1.42695 WP_003898819.1.42704 WP_003898819.1.42705 WP_003898819.1.42722 WP_003898819.1.42777 WP_003898819.1.42782 WP_003898819.1.42835 WP_003898819.1.42839 WP_003898819.1.42842 WP_003898819.1.42905 WP_003898819.1.42916 WP_003898819.1.42930 WP_003898819.1.42971 WP_003898819.1.43005 WP_003898819.1.43009 WP_003898819.1.43053 WP_003898819.1.43082 WP_003898819.1.43087 WP_003898819.1.43098 WP_003898819.1.43208 WP_003898819.1.43236 WP_003898819.1.43246 WP_003898819.1.43255 WP_003898819.1.43266 WP_003898819.1.43269 WP_003898819.1.43273 WP_003898819.1.43296 WP_003898819.1.43306 WP_003898819.1.4335 WP_003898819.1.43368 WP_003898819.1.43395 WP_003898819.1.43457 WP_003898819.1.43462 WP_003898819.1.43475 WP_003898819.1.43478 WP_003898819.1.43484 WP_003898819.1.43557 WP_003898819.1.43578 WP_003898819.1.43588 WP_003898819.1.43643 WP_003898819.1.43664 WP_003898819.1.43684 WP_003898819.1.43686 WP_003898819.1.43706 WP_003898819.1.43716 WP_003898819.1.4377 WP_003898819.1.43781 WP_003898819.1.43794 WP_003898819.1.43815 WP_003898819.1.43846 WP_003898819.1.43861 WP_003898819.1.43863 WP_003898819.1.43866 WP_003898819.1.43872 WP_003898819.1.43885 WP_003898819.1.43897 WP_003898819.1.4390 WP_003898819.1.43902 WP_003898819.1.43921 WP_003898819.1.43936 WP_003898819.1.43937 WP_003898819.1.43960 WP_003898819.1.43965 WP_003898819.1.4399 WP_003898819.1.43993 WP_003898819.1.43996 WP_003898819.1.44 WP_003898819.1.44001 WP_003898819.1.44008 WP_003898819.1.44016 WP_003898819.1.44033 WP_003898819.1.44037 WP_003898819.1.44041 WP_003898819.1.44070 WP_003898819.1.44071 WP_003898819.1.44076 WP_003898819.1.44104 WP_003898819.1.44111 WP_003898819.1.44124 WP_003898819.1.44169 WP_003898819.1.44219 WP_003898819.1.44237 WP_003898819.1.44277 WP_003898819.1.44279 WP_003898819.1.44336 WP_003898819.1.44355 WP_003898819.1.44358 WP_003898819.1.4438 WP_003898819.1.44390 WP_003898819.1.44392 WP_003898819.1.4441 WP_003898819.1.44415 WP_003898819.1.44464 WP_003898819.1.44466 WP_003898819.1.44489 WP_003898819.1.44492 WP_003898819.1.44494 WP_003898819.1.44500 WP_003898819.1.44519 WP_003898819.1.44526 WP_003898819.1.44532 WP_003898819.1.44534 WP_003898819.1.44562 WP_003898819.1.44589 WP_003898819.1.44597 WP_003898819.1.44600 WP_003898819.1.44602 WP_003898819.1.44615 WP_003898819.1.4464 WP_003898819.1.44651 WP_003898819.1.44659 WP_003898819.1.44665 WP_003898819.1.44694 WP_003898819.1.44700 WP_003898819.1.44713 WP_003898819.1.44735 WP_003898819.1.44740 WP_003898819.1.44757 WP_003898819.1.4476 WP_003898819.1.44761 WP_003898819.1.44767 WP_003898819.1.44776 WP_003898819.1.44779 WP_003898819.1.44786 WP_003898819.1.44808 WP_003898819.1.44864 WP_003898819.1.44901 WP_003898819.1.44908 WP_003898819.1.44913 WP_003898819.1.4492 WP_003898819.1.44939 WP_003898819.1.44979 WP_003898819.1.44981 WP_003898819.1.45002 WP_003898819.1.45011 WP_003898819.1.4504 WP_003898819.1.45062 WP_003898819.1.45066 WP_003898819.1.45081 WP_003898819.1.45113 WP_003898819.1.45129 WP_003898819.1.45135 WP_003898819.1.45147 WP_003898819.1.45168 WP_003898819.1.4517 WP_003898819.1.45181 WP_003898819.1.45185 WP_003898819.1.45192 WP_003898819.1.45200 WP_003898819.1.45205 WP_003898819.1.45211 WP_003898819.1.4526 WP_003898819.1.45286 WP_003898819.1.45326 WP_003898819.1.45347 WP_003898819.1.45374 WP_003898819.1.45390 WP_003898819.1.454 WP_003898819.1.45407 WP_003898819.1.45451 WP_003898819.1.45453 WP_003898819.1.45460 WP_003898819.1.45463 WP_003898819.1.45470 WP_003898819.1.45474 WP_003898819.1.45491 WP_003898819.1.45510 WP_003898819.1.45563 WP_003898819.1.45584 WP_003898819.1.45590 WP_003898819.1.45619 WP_003898819.1.45626 WP_003898819.1.45631 WP_003898819.1.45666 WP_003898819.1.45697 WP_003898819.1.4571 WP_003898819.1.45731 WP_003898819.1.45743 WP_003898819.1.45765 WP_003898819.1.45776 WP_003898819.1.45783 WP_003898819.1.45805 WP_003898819.1.45815 WP_003898819.1.45849 WP_003898819.1.45867 WP_003898819.1.45884 WP_003898819.1.4590 WP_003898819.1.45923 WP_003898819.1.45926 WP_003898819.1.45963 WP_003898819.1.45989 WP_003898819.1.45992 WP_003898819.1.46025 WP_003898819.1.46083 WP_003898819.1.46090 WP_003898819.1.46092 WP_003898819.1.46100 WP_003898819.1.46101 WP_003898819.1.46103 WP_003898819.1.46107 WP_003898819.1.46127 WP_003898819.1.46128 WP_003898819.1.46129 WP_003898819.1.46141 WP_003898819.1.46150 WP_003898819.1.46201 WP_003898819.1.46226 WP_003898819.1.4624 WP_003898819.1.46253 WP_003898819.1.46268 WP_003898819.1.46285 WP_003898819.1.46300 WP_003898819.1.46313 WP_003898819.1.46336 WP_003898819.1.46365 WP_003898819.1.46370 WP_003898819.1.46381 WP_003898819.1.46402 WP_003898819.1.46411 WP_003898819.1.4644 WP_003898819.1.46442 WP_003898819.1.46453 WP_003898819.1.46463 WP_003898819.1.46478 WP_003898819.1.46492 WP_003898819.1.46521 WP_003898819.1.4653 WP_003898819.1.46532 WP_003898819.1.46539 WP_003898819.1.46568 WP_003898819.1.46585 WP_003898819.1.46609 WP_003898819.1.46613 WP_003898819.1.46625 WP_003898819.1.46642 WP_003898819.1.46647 WP_003898819.1.46674 WP_003898819.1.46724 WP_003898819.1.46758 WP_003898819.1.46773 WP_003898819.1.46777 WP_003898819.1.46786 WP_003898819.1.46792 WP_003898819.1.46847 WP_003898819.1.46851 WP_003898819.1.4687 WP_003898819.1.46897 WP_003898819.1.46936 WP_003898819.1.46980 WP_003898819.1.47011 WP_003898819.1.47066 WP_003898819.1.47077 WP_003898819.1.47083 WP_003898819.1.47106 WP_003898819.1.47147 WP_003898819.1.47166 WP_003898819.1.47178 WP_003898819.1.47179 WP_003898819.1.47194 WP_003898819.1.47207 WP_003898819.1.47210 WP_003898819.1.47261 WP_003898819.1.47262 WP_003898819.1.47402 WP_003898819.1.47423 WP_003898819.1.47467 WP_003898819.1.47502 WP_003898819.1.4751 WP_003898819.1.47511 WP_003898819.1.47537 WP_003898819.1.47540 WP_003898819.1.47568 WP_003898819.1.47572 WP_003898819.1.47588 WP_003898819.1.47636 WP_003898819.1.4764 WP_003898819.1.47653 WP_003898819.1.47679 WP_003898819.1.47681 WP_003898819.1.47690 WP_003898819.1.4771 WP_003898819.1.47717 WP_003898819.1.47743 WP_003898819.1.47754 WP_003898819.1.47773 WP_003898819.1.47776 WP_003898819.1.47780 WP_003898819.1.47805 WP_003898819.1.47832 WP_003898819.1.47847 WP_003898819.1.47858 WP_003898819.1.47861 WP_003898819.1.47868 WP_003898819.1.47893 WP_003898819.1.47899 WP_003898819.1.479 WP_003898819.1.47912 WP_003898819.1.47913 WP_003898819.1.47926 WP_003898819.1.4794 WP_003898819.1.47943 WP_003898819.1.47944 WP_003898819.1.47959 WP_003898819.1.47974 WP_003898819.1.47993 WP_003898819.1.48004 WP_003898819.1.48039 WP_003898819.1.48050 WP_003898819.1.48084 WP_003898819.1.48097 WP_003898819.1.48101 WP_003898819.1.48109 WP_003898819.1.4813 WP_003898819.1.48130 WP_003898819.1.48135 WP_003898819.1.48143 WP_003898819.1.48152 WP_003898819.1.48155 WP_003898819.1.48170 WP_003898819.1.48173 WP_003898819.1.48177 WP_003898819.1.48185 WP_003898819.1.48204 WP_003898819.1.48219 WP_003898819.1.4823 WP_003898819.1.48240 WP_003898819.1.48256 WP_003898819.1.48264 WP_003898819.1.48287 WP_003898819.1.48330 WP_003898819.1.48333 WP_003898819.1.48348 WP_003898819.1.48354 WP_003898819.1.48372 WP_003898819.1.48383 WP_003898819.1.48388 WP_003898819.1.48419 WP_003898819.1.48423 WP_003898819.1.48443 WP_003898819.1.48450 WP_003898819.1.48462 WP_003898819.1.48550 WP_003898819.1.48605 WP_003898819.1.48618 WP_003898819.1.4863 WP_003898819.1.48648 WP_003898819.1.48658 WP_003898819.1.48666 WP_003898819.1.48687 WP_003898819.1.48779 WP_003898819.1.4878 WP_003898819.1.48798 WP_003898819.1.48802 WP_003898819.1.48831 WP_003898819.1.48843 WP_003898819.1.48857 WP_003898819.1.4890 WP_003898819.1.48946 WP_003898819.1.48979 WP_003898819.1.49017 WP_003898819.1.49048 WP_003898819.1.49059 WP_003898819.1.4906 WP_003898819.1.4907 WP_003898819.1.49103 WP_003898819.1.49110 WP_003898819.1.49111 WP_003898819.1.4919 WP_003898819.1.49251 WP_003898819.1.49263 WP_003898819.1.49291 WP_003898819.1.49296 WP_003898819.1.49335 WP_003898819.1.49337 WP_003898819.1.49419 WP_003898819.1.49426 WP_003898819.1.49437 WP_003898819.1.49439 WP_003898819.1.49474 WP_003898819.1.49506 WP_003898819.1.49516 WP_003898819.1.49523 WP_003898819.1.49526 WP_003898819.1.49532 WP_003898819.1.49588 WP_003898819.1.4959 WP_003898819.1.49678 WP_003898819.1.49687 WP_003898819.1.49699 WP_003898819.1.49709 WP_003898819.1.4971 WP_003898819.1.4972 WP_003898819.1.49736 WP_003898819.1.49746 WP_003898819.1.49764 WP_003898819.1.49773 WP_003898819.1.49796 WP_003898819.1.49814 WP_003898819.1.49815 WP_003898819.1.49816 WP_003898819.1.49839 WP_003898819.1.49857 WP_003898819.1.49878 WP_003898819.1.49880 WP_003898819.1.49944 WP_003898819.1.4999 WP_003898819.1.50068 WP_003898819.1.5008 WP_003898819.1.50081 WP_003898819.1.50122 WP_003898819.1.50126 WP_003898819.1.50149 WP_003898819.1.50162 WP_003898819.1.5018 WP_003898819.1.50194 WP_003898819.1.50235 WP_003898819.1.50249 WP_003898819.1.50265 WP_003898819.1.50271 WP_003898819.1.50324 WP_003898819.1.50347 WP_003898819.1.50372 WP_003898819.1.50398 WP_003898819.1.50407 WP_003898819.1.50444 WP_003898819.1.50466 WP_003898819.1.5048 WP_003898819.1.5050 WP_003898819.1.50540 WP_003898819.1.50554 WP_003898819.1.50557 WP_003898819.1.50601 WP_003898819.1.50610 WP_003898819.1.50632 WP_003898819.1.50633 WP_003898819.1.50642 WP_003898819.1.50655 WP_003898819.1.50659 WP_003898819.1.50683 WP_003898819.1.50689 WP_003898819.1.50692 WP_003898819.1.50714 WP_003898819.1.50729 WP_003898819.1.50756 WP_003898819.1.50784 WP_003898819.1.50794 WP_003898819.1.50841 WP_003898819.1.50860 WP_003898819.1.50868 WP_003898819.1.50877 WP_003898819.1.5096 WP_003898819.1.50981 WP_003898819.1.50987 WP_003898819.1.51003 WP_003898819.1.51009 WP_003898819.1.51037 WP_003898819.1.51074 WP_003898819.1.51082 WP_003898819.1.51101 WP_003898819.1.51116 WP_003898819.1.51149 WP_003898819.1.51156 WP_003898819.1.51157 WP_003898819.1.51213 WP_003898819.1.51232 WP_003898819.1.51239 WP_003898819.1.51266 WP_003898819.1.51279 WP_003898819.1.51291 WP_003898819.1.51294 WP_003898819.1.51301 WP_003898819.1.51329 WP_003898819.1.51391 WP_003898819.1.51422 WP_003898819.1.51445 WP_003898819.1.51455 WP_003898819.1.51466 WP_003898819.1.51468 WP_003898819.1.51478 WP_003898819.1.51497 WP_003898819.1.51520 WP_003898819.1.51593 WP_003898819.1.51628 WP_003898819.1.5164 WP_003898819.1.51647 WP_003898819.1.51660 WP_003898819.1.51696 WP_003898819.1.51721 WP_003898819.1.51788 WP_003898819.1.51795 WP_003898819.1.51801 WP_003898819.1.51817 WP_003898819.1.51819 WP_003898819.1.51854 WP_003898819.1.51923 WP_003898819.1.51942 WP_003898819.1.51948 WP_003898819.1.51963 WP_003898819.1.51969 WP_003898819.1.52000 WP_003898819.1.52001 WP_003898819.1.52003 WP_003898819.1.52006 WP_003898819.1.52036 WP_003898819.1.52038 WP_003898819.1.52046 WP_003898819.1.52059 WP_003898819.1.52069 WP_003898819.1.52082 WP_003898819.1.52102 WP_003898819.1.52106 WP_003898819.1.52166 WP_003898819.1.52168 WP_003898819.1.52173 WP_003898819.1.52178 WP_003898819.1.52206 WP_003898819.1.52216 WP_003898819.1.52238 WP_003898819.1.52241 WP_003898819.1.52280 WP_003898819.1.52314 WP_003898819.1.52385 WP_003898819.1.52390 WP_003898819.1.524 WP_003898819.1.52460 WP_003898819.1.52485 WP_003898819.1.52486 WP_003898819.1.52504 WP_003898819.1.52522 WP_003898819.1.52531 WP_003898819.1.52533 WP_003898819.1.52545 WP_003898819.1.52553 WP_003898819.1.52563 WP_003898819.1.52564 WP_003898819.1.52574 WP_003898819.1.52641 WP_003898819.1.52673 WP_003898819.1.52674 WP_003898819.1.52708 WP_003898819.1.52713 WP_003898819.1.52761 WP_003898819.1.52778 WP_003898819.1.52791 WP_003898819.1.52797 WP_003898819.1.52818 WP_003898819.1.52872 WP_003898819.1.52873 WP_003898819.1.52891 WP_003898819.1.52892 WP_003898819.1.52909 WP_003898819.1.52970 WP_003898819.1.52998 WP_003898819.1.53053 WP_003898819.1.53056 WP_003898819.1.5306 WP_003898819.1.53088 WP_003898819.1.5309 WP_003898819.1.531 WP_003898819.1.53117 WP_003898819.1.53118 WP_003898819.1.53142 WP_003898819.1.53143 WP_003898819.1.53157 WP_003898819.1.53167 WP_003898819.1.53200 WP_003898819.1.53204 WP_003898819.1.53213 WP_003898819.1.53217 WP_003898819.1.53226 WP_003898819.1.53229 WP_003898819.1.53230 WP_003898819.1.53237 WP_003898819.1.53254 WP_003898819.1.53257 WP_003898819.1.53276 WP_003898819.1.53278 WP_003898819.1.533 WP_003898819.1.53302 WP_003898819.1.53306 WP_003898819.1.5334 WP_003898819.1.5335 WP_003898819.1.53353 WP_003898819.1.53381 WP_003898819.1.53413 WP_003898819.1.53458 WP_003898819.1.53460 WP_003898819.1.53480 WP_003898819.1.53517 WP_003898819.1.53522 WP_003898819.1.53525 WP_003898819.1.53526 WP_003898819.1.53553 WP_003898819.1.53606 WP_003898819.1.53609 WP_003898819.1.53628 WP_003898819.1.53643 WP_003898819.1.53667 WP_003898819.1.53679 WP_003898819.1.53715 WP_003898819.1.53730 WP_003898819.1.53742 WP_003898819.1.53743 WP_003898819.1.53754 WP_003898819.1.53775 WP_003898819.1.53787 WP_003898819.1.53803 WP_003898819.1.53818 WP_003898819.1.53822 WP_003898819.1.53853 WP_003898819.1.53865 WP_003898819.1.53888 WP_003898819.1.53900 WP_003898819.1.53912 WP_003898819.1.53914 WP_003898819.1.53952 WP_003898819.1.53973 WP_003898819.1.5398 WP_003898819.1.5408 WP_003898819.1.54089 WP_003898819.1.54093 WP_003898819.1.54099 WP_003898819.1.54112 WP_003898819.1.54125 WP_003898819.1.54141 WP_003898819.1.54162 WP_003898819.1.54179 WP_003898819.1.54218 WP_003898819.1.54225 WP_003898819.1.54227 WP_003898819.1.54232 WP_003898819.1.54241 WP_003898819.1.54245 WP_003898819.1.54247 WP_003898819.1.54260 WP_003898819.1.54275 WP_003898819.1.54280 WP_003898819.1.5429 WP_003898819.1.54314 WP_003898819.1.54351 WP_003898819.1.54370 WP_003898819.1.54428 WP_003898819.1.54449 WP_003898819.1.54494 WP_003898819.1.54502 WP_003898819.1.54514 WP_003898819.1.54519 WP_003898819.1.5452 WP_003898819.1.54531 WP_003898819.1.54537 WP_003898819.1.54553 WP_003898819.1.54555 WP_003898819.1.54575 WP_003898819.1.54633 WP_003898819.1.54686 WP_003898819.1.54687 WP_003898819.1.54705 WP_003898819.1.54730 WP_003898819.1.54732 WP_003898819.1.5475 WP_003898819.1.54797 WP_003898819.1.54807 WP_003898819.1.54836 WP_003898819.1.54838 WP_003898819.1.54860 WP_003898819.1.54888 WP_003898819.1.54897 WP_003898819.1.54905 WP_003898819.1.54909 WP_003898819.1.54937 WP_003898819.1.54939 WP_003898819.1.54944 WP_003898819.1.54945 WP_003898819.1.54953 WP_003898819.1.54964 WP_003898819.1.55015 WP_003898819.1.55022 WP_003898819.1.55023 WP_003898819.1.55051 WP_003898819.1.55088 WP_003898819.1.55106 WP_003898819.1.55126 WP_003898819.1.55128 WP_003898819.1.55140 WP_003898819.1.55150 WP_003898819.1.55210 WP_003898819.1.55227 WP_003898819.1.55248 WP_003898819.1.55257 WP_003898819.1.55267 WP_003898819.1.55279 WP_003898819.1.55307 WP_003898819.1.55326 WP_003898819.1.55328 WP_003898819.1.5533 WP_003898819.1.55396 WP_003898819.1.55398 WP_003898819.1.55441 WP_003898819.1.55459 WP_003898819.1.55501 WP_003898819.1.55504 WP_003898819.1.55578 WP_003898819.1.55626 WP_003898819.1.55641 WP_003898819.1.5569 WP_003898819.1.55723 WP_003898819.1.55735 WP_003898819.1.5574 WP_003898819.1.55772 WP_003898819.1.55802 WP_003898819.1.55807 WP_003898819.1.55819 WP_003898819.1.55821 WP_003898819.1.5583 WP_003898819.1.55849 WP_003898819.1.55856 WP_003898819.1.55860 WP_003898819.1.55882 WP_003898819.1.55883 WP_003898819.1.55894 WP_003898819.1.55902 WP_003898819.1.55908 WP_003898819.1.55909 WP_003898819.1.5591 WP_003898819.1.55961 WP_003898819.1.55977 WP_003898819.1.55983 WP_003898819.1.56028 WP_003898819.1.56057 WP_003898819.1.56060 WP_003898819.1.56107 WP_003898819.1.56132 WP_003898819.1.56163 WP_003898819.1.56167 WP_003898819.1.56178 WP_003898819.1.56287 WP_003898819.1.56292 WP_003898819.1.56327 WP_003898819.1.56341 WP_003898819.1.56359 WP_003898819.1.56365 WP_003898819.1.56394 WP_003898819.1.56443 WP_003898819.1.56473 WP_003898819.1.56478 WP_003898819.1.56500 WP_003898819.1.56517 WP_003898819.1.56534 WP_003898819.1.5656 WP_003898819.1.56577 WP_003898819.1.56593 WP_003898819.1.56625 WP_003898819.1.56637 WP_003898819.1.56670 WP_003898819.1.56697 WP_003898819.1.567 WP_003898819.1.56701 WP_003898819.1.56709 WP_003898819.1.56729 WP_003898819.1.56743 WP_003898819.1.56755 WP_003898819.1.56764 WP_003898819.1.56769 WP_003898819.1.56770 WP_003898819.1.56795 WP_003898819.1.5681 WP_003898819.1.56839 WP_003898819.1.56863 WP_003898819.1.56868 WP_003898819.1.56869 WP_003898819.1.56915 WP_003898819.1.56926 WP_003898819.1.56961 WP_003898819.1.56971 WP_003898819.1.56972 WP_003898819.1.57023 WP_003898819.1.57035 WP_003898819.1.57077 WP_003898819.1.57087 WP_003898819.1.57094 WP_003898819.1.57134 WP_003898819.1.57151 WP_003898819.1.57169 WP_003898819.1.57208 WP_003898819.1.57212 WP_003898819.1.57230 WP_003898819.1.5724 WP_003898819.1.5725 WP_003898819.1.5727 WP_003898819.1.57273 WP_003898819.1.573 WP_003898819.1.57314 WP_003898819.1.57326 WP_003898819.1.57328 WP_003898819.1.57331 WP_003898819.1.57340 WP_003898819.1.57351 WP_003898819.1.57352 WP_003898819.1.57380 WP_003898819.1.57430 WP_003898819.1.5744 WP_003898819.1.57440 WP_003898819.1.5745 WP_003898819.1.57461 WP_003898819.1.57469 WP_003898819.1.57489 WP_003898819.1.575 WP_003898819.1.57509 WP_003898819.1.57519 WP_003898819.1.57525 WP_003898819.1.57551 WP_003898819.1.5758 WP_003898819.1.57596 WP_003898819.1.57604 WP_003898819.1.57616 WP_003898819.1.57617 WP_003898819.1.57619 WP_003898819.1.57627 WP_003898819.1.57642 WP_003898819.1.57658 WP_003898819.1.57667 WP_003898819.1.57675 WP_003898819.1.57689 WP_003898819.1.57708 WP_003898819.1.57794 WP_003898819.1.57821 WP_003898819.1.57825 WP_003898819.1.57843 WP_003898819.1.57906 WP_003898819.1.57924 WP_003898819.1.57926 WP_003898819.1.57930 WP_003898819.1.57957 WP_003898819.1.57960 WP_003898819.1.57964 WP_003898819.1.57991 WP_003898819.1.58000 WP_003898819.1.58086 WP_003898819.1.58101 WP_003898819.1.58103 WP_003898819.1.58108 WP_003898819.1.5811 WP_003898819.1.58121 WP_003898819.1.58145 WP_003898819.1.58164 WP_003898819.1.58174 WP_003898819.1.582 WP_003898819.1.58202 WP_003898819.1.58209 WP_003898819.1.58215 WP_003898819.1.5824 WP_003898819.1.58250 WP_003898819.1.58259 WP_003898819.1.58283 WP_003898819.1.58303 WP_003898819.1.58311 WP_003898819.1.58330 WP_003898819.1.58359 WP_003898819.1.58386 WP_003898819.1.58393 WP_003898819.1.58431 WP_003898819.1.5844 WP_003898819.1.58457 WP_003898819.1.58488 WP_003898819.1.58518 WP_003898819.1.58534 WP_003898819.1.58559 WP_003898819.1.58567 WP_003898819.1.58573 WP_003898819.1.58602 WP_003898819.1.58612 WP_003898819.1.58619 WP_003898819.1.58630 WP_003898819.1.5865 WP_003898819.1.58671 WP_003898819.1.58690 WP_003898819.1.58702 WP_003898819.1.58754 WP_003898819.1.5879 WP_003898819.1.5881 WP_003898819.1.58824 WP_003898819.1.58848 WP_003898819.1.58857 WP_003898819.1.58891 WP_003898819.1.58892 WP_003898819.1.5890 WP_003898819.1.58904 WP_003898819.1.58921 WP_003898819.1.58930 WP_003898819.1.58939 WP_003898819.1.58941 WP_003898819.1.58953 WP_003898819.1.58961 WP_003898819.1.5898 WP_003898819.1.59025 WP_003898819.1.59029 WP_003898819.1.59037 WP_003898819.1.59044 WP_003898819.1.59085 WP_003898819.1.59088 WP_003898819.1.59130 WP_003898819.1.5914 WP_003898819.1.59147 WP_003898819.1.59166 WP_003898819.1.59205 WP_003898819.1.59209 WP_003898819.1.59237 WP_003898819.1.59240 WP_003898819.1.59254 WP_003898819.1.59262 WP_003898819.1.59270 WP_003898819.1.5928 WP_003898819.1.59304 WP_003898819.1.59305 WP_003898819.1.59309 WP_003898819.1.59316 WP_003898819.1.59326 WP_003898819.1.59328 WP_003898819.1.59333 WP_003898819.1.59338 WP_003898819.1.59388 WP_003898819.1.59487 WP_003898819.1.59537 WP_003898819.1.59561 WP_003898819.1.59677 WP_003898819.1.59722 WP_003898819.1.59732 WP_003898819.1.59738 WP_003898819.1.59750 WP_003898819.1.59757 WP_003898819.1.59761 WP_003898819.1.59808 WP_003898819.1.59850 WP_003898819.1.59856 WP_003898819.1.59860 WP_003898819.1.59861 WP_003898819.1.5987 WP_003898819.1.59878 WP_003898819.1.59888 WP_003898819.1.59952 WP_003898819.1.5996 WP_003898819.1.59961 WP_003898819.1.59974 WP_003898819.1.6000 WP_003898819.1.60007 WP_003898819.1.60016 WP_003898819.1.6003 WP_003898819.1.60047 WP_003898819.1.6007 WP_003898819.1.60121 WP_003898819.1.60135 WP_003898819.1.60139 WP_003898819.1.60152 WP_003898819.1.60171 WP_003898819.1.60197 WP_003898819.1.6020 WP_003898819.1.60205 WP_003898819.1.60207 WP_003898819.1.60215 WP_003898819.1.60217 WP_003898819.1.60267 WP_003898819.1.60288 WP_003898819.1.60291 WP_003898819.1.60301 WP_003898819.1.60305 WP_003898819.1.60312 WP_003898819.1.60313 WP_003898819.1.60314 WP_003898819.1.60367 WP_003898819.1.60376 WP_003898819.1.60403 WP_003898819.1.60413 WP_003898819.1.60421 WP_003898819.1.60451 WP_003898819.1.60460 WP_003898819.1.60479 WP_003898819.1.60487 WP_003898819.1.60512 WP_003898819.1.60573 WP_003898819.1.60632 WP_003898819.1.60657 WP_003898819.1.60687 WP_003898819.1.60689 WP_003898819.1.60727 WP_003898819.1.60738 WP_003898819.1.60763 WP_003898819.1.6077 WP_003898819.1.60791 WP_003898819.1.60834 WP_003898819.1.60870 WP_003898819.1.60878 WP_003898819.1.60879 WP_003898819.1.60913 WP_003898819.1.60978 WP_003898819.1.61000 WP_003898819.1.61001 WP_003898819.1.61012 WP_003898819.1.61014 WP_003898819.1.61015 WP_003898819.1.61037 WP_003898819.1.61052 WP_003898819.1.61065 WP_003898819.1.61100 WP_003898819.1.61101 WP_003898819.1.61138 WP_003898819.1.61142 WP_003898819.1.61198 WP_003898819.1.61234 WP_003898819.1.61256 WP_003898819.1.61281 WP_003898819.1.61314 WP_003898819.1.61321 WP_003898819.1.61326 WP_003898819.1.61368 WP_003898819.1.61391 WP_003898819.1.61406 WP_003898819.1.61409 WP_003898819.1.61422 WP_003898819.1.61425 WP_003898819.1.61428 WP_003898819.1.61469 WP_003898819.1.61494 WP_003898819.1.61522 WP_003898819.1.61552 WP_003898819.1.61557 WP_003898819.1.61567 WP_003898819.1.61571 WP_003898819.1.61573 WP_003898819.1.61584 WP_003898819.1.61586 WP_003898819.1.6159 WP_003898819.1.61592 WP_003898819.1.6160 WP_003898819.1.61614 WP_003898819.1.6163 WP_003898819.1.61655 WP_003898819.1.61665 WP_003898819.1.61669 WP_003898819.1.61682 WP_003898819.1.61692 WP_003898819.1.61728 WP_003898819.1.61750 WP_003898819.1.61754 WP_003898819.1.61755 WP_003898819.1.61757 WP_003898819.1.61778 WP_003898819.1.6179 WP_003898819.1.61793 WP_003898819.1.61816 WP_003898819.1.61842 WP_003898819.1.61850 WP_003898819.1.61862 WP_003898819.1.61865 WP_003898819.1.61868 WP_003898819.1.61911 WP_003898819.1.61925 WP_003898819.1.61941 WP_003898819.1.61953 WP_003898819.1.61979 WP_003898819.1.61986 WP_003898819.1.61987 WP_003898819.1.61998 WP_003898819.1.62021 WP_003898819.1.62087 WP_003898819.1.62089 WP_003898819.1.62101 WP_003898819.1.62104 WP_003898819.1.6211 WP_003898819.1.62132 WP_003898819.1.62162 WP_003898819.1.62225 WP_003898819.1.62230 WP_003898819.1.62238 WP_003898819.1.62249 WP_003898819.1.62270 WP_003898819.1.62281 WP_003898819.1.62307 WP_003898819.1.6231 WP_003898819.1.62359 WP_003898819.1.62360 WP_003898819.1.62371 WP_003898819.1.62379 WP_003898819.1.62395 WP_003898819.1.62449 WP_003898819.1.62468 WP_003898819.1.6248 WP_003898819.1.62508 WP_003898819.1.62565 WP_003898819.1.62594 WP_003898819.1.62606 WP_003898819.1.62616 WP_003898819.1.62666 WP_003898819.1.62687 WP_003898819.1.62715 WP_003898819.1.62730 WP_003898819.1.62738 WP_003898819.1.62761 WP_003898819.1.62766 WP_003898819.1.62813 WP_003898819.1.62839 WP_003898819.1.62841 WP_003898819.1.62909 WP_003898819.1.62936 WP_003898819.1.6294 WP_003898819.1.6295 WP_003898819.1.62962 WP_003898819.1.63007 WP_003898819.1.63019 WP_003898819.1.63032 WP_003898819.1.63037 WP_003898819.1.63064 WP_003898819.1.63066 WP_003898819.1.63072 WP_003898819.1.6308 WP_003898819.1.63096 WP_003898819.1.63106 WP_003898819.1.6314 WP_003898819.1.63144 WP_003898819.1.63154 WP_003898819.1.63160 WP_003898819.1.63161 WP_003898819.1.63166 WP_003898819.1.63175 WP_003898819.1.63194 WP_003898819.1.6322 WP_003898819.1.63222 WP_003898819.1.63247 WP_003898819.1.6328 WP_003898819.1.63291 WP_003898819.1.63312 WP_003898819.1.63317 WP_003898819.1.63331 WP_003898819.1.63373 WP_003898819.1.63384 WP_003898819.1.63403 WP_003898819.1.63428 WP_003898819.1.6345 WP_003898819.1.63464 WP_003898819.1.63483 WP_003898819.1.63502 WP_003898819.1.63504 WP_003898819.1.63522 WP_003898819.1.63530 WP_003898819.1.63538 WP_003898819.1.63564 WP_003898819.1.63567 WP_003898819.1.63596 WP_003898819.1.63600 WP_003898819.1.63623 WP_003898819.1.63624 WP_003898819.1.63625 WP_003898819.1.63627 WP_003898819.1.63654 WP_003898819.1.63662 WP_003898819.1.63711 WP_003898819.1.63734 WP_003898819.1.63807 WP_003898819.1.63819 WP_003898819.1.63844 WP_003898819.1.63888 WP_003898819.1.63913 WP_003898819.1.63915 WP_003898819.1.63918 WP_003898819.1.63961 WP_003898819.1.63970 WP_003898819.1.64000 WP_003898819.1.64027 WP_003898819.1.64058 WP_003898819.1.64065 WP_003898819.1.6407 WP_003898819.1.64082 WP_003898819.1.64091 WP_003898819.1.64102 WP_003898819.1.64104 WP_003898819.1.64119 WP_003898819.1.64169 WP_003898819.1.64219 WP_003898819.1.6422 WP_003898819.1.64222 WP_003898819.1.64223 WP_003898819.1.64228 WP_003898819.1.64235 WP_003898819.1.64249 WP_003898819.1.6427 WP_003898819.1.64278 WP_003898819.1.64287 WP_003898819.1.64414 WP_003898819.1.64419 WP_003898819.1.6443 WP_003898819.1.64463 WP_003898819.1.64480 WP_003898819.1.64497 WP_003898819.1.64506 WP_003898819.1.64511 WP_003898819.1.64513 WP_003898819.1.64514 WP_003898819.1.64515 WP_003898819.1.64522 WP_003898819.1.64526 WP_003898819.1.64543 WP_003898819.1.6456 WP_003898819.1.64567 WP_003898819.1.64588 WP_003898819.1.64589 WP_003898819.1.64594 WP_003898819.1.64595 WP_003898819.1.64608 WP_003898819.1.64619 WP_003898819.1.64629 WP_003898819.1.6464 WP_003898819.1.64664 WP_003898819.1.64669 WP_003898819.1.64672 WP_003898819.1.64680 WP_003898819.1.64682 WP_003898819.1.64729 WP_003898819.1.64774 WP_003898819.1.64776 WP_003898819.1.64802 WP_003898819.1.64832 WP_003898819.1.6486 WP_003898819.1.64870 WP_003898819.1.64898 WP_003898819.1.64922 WP_003898819.1.64924 WP_003898819.1.6493 WP_003898819.1.64941 WP_003898819.1.64966 WP_003898819.1.64973 WP_003898819.1.65001 WP_003898819.1.65026 WP_003898819.1.65053 WP_003898819.1.65070 WP_003898819.1.65079 WP_003898819.1.65102 WP_003898819.1.65157 WP_003898819.1.65181 WP_003898819.1.65212 WP_003898819.1.65229 WP_003898819.1.6523 WP_003898819.1.65253 WP_003898819.1.65289 WP_003898819.1.65291 WP_003898819.1.65315 WP_003898819.1.65329 WP_003898819.1.65359 WP_003898819.1.6536 WP_003898819.1.65374 WP_003898819.1.65386 WP_003898819.1.65414 WP_003898819.1.65416 WP_003898819.1.65433 WP_003898819.1.65455 WP_003898819.1.65467 WP_003898819.1.65488 WP_003898819.1.65529 WP_003898819.1.65539 WP_003898819.1.65583 WP_003898819.1.65612 WP_003898819.1.65623 WP_003898819.1.65635 WP_003898819.1.65637 WP_003898819.1.65648 WP_003898819.1.65683 WP_003898819.1.65686 WP_003898819.1.65688 WP_003898819.1.65707 WP_003898819.1.65733 WP_003898819.1.65746 WP_003898819.1.65747 WP_003898819.1.65759 WP_003898819.1.65816 WP_003898819.1.65830 WP_003898819.1.65858 WP_003898819.1.65862 WP_003898819.1.65869 WP_003898819.1.65893 WP_003898819.1.65929 WP_003898819.1.65932 WP_003898819.1.65958 WP_003898819.1.65974 WP_003898819.1.66004 WP_003898819.1.66013 WP_003898819.1.6606 WP_003898819.1.66089 WP_003898819.1.66149 WP_003898819.1.66151 WP_003898819.1.66229 WP_003898819.1.66276 WP_003898819.1.66293 WP_003898819.1.66297 WP_003898819.1.66323 WP_003898819.1.66325 WP_003898819.1.6633 WP_003898819.1.66334 WP_003898819.1.66355 WP_003898819.1.66367 WP_003898819.1.66394 WP_003898819.1.66396 WP_003898819.1.66451 WP_003898819.1.66455 WP_003898819.1.66457 WP_003898819.1.66460 WP_003898819.1.66464 WP_003898819.1.66466 WP_003898819.1.66487 WP_003898819.1.66504 WP_003898819.1.66544 WP_003898819.1.66558 WP_003898819.1.66580 WP_003898819.1.66582 WP_003898819.1.66612 WP_003898819.1.66615 WP_003898819.1.66617 WP_003898819.1.66635 WP_003898819.1.66656 WP_003898819.1.66663 WP_003898819.1.66675 WP_003898819.1.66715 WP_003898819.1.66718 WP_003898819.1.66762 WP_003898819.1.66776 WP_003898819.1.66808 WP_003898819.1.66817 WP_003898819.1.66819 WP_003898819.1.66826 WP_003898819.1.66830 WP_003898819.1.66842 WP_003898819.1.66868 WP_003898819.1.66878 WP_003898819.1.66880 WP_003898819.1.66893 WP_003898819.1.66961 WP_003898819.1.67005 WP_003898819.1.6704 WP_003898819.1.67044 WP_003898819.1.67061 WP_003898819.1.67089 WP_003898819.1.67098 WP_003898819.1.67146 WP_003898819.1.67170 WP_003898819.1.67197 WP_003898819.1.67198 WP_003898819.1.6720 WP_003898819.1.67207 WP_003898819.1.67218 WP_003898819.1.67220 WP_003898819.1.67225 WP_003898819.1.67231 WP_003898819.1.6724 WP_003898819.1.67257 WP_003898819.1.67298 WP_003898819.1.67307 WP_003898819.1.67324 WP_003898819.1.67332 WP_003898819.1.67346 WP_003898819.1.67354 WP_003898819.1.67360 WP_003898819.1.67381 WP_003898819.1.67396 WP_003898819.1.67417 WP_003898819.1.67422 WP_003898819.1.67453 WP_003898819.1.67459 WP_003898819.1.67473 WP_003898819.1.67481 WP_003898819.1.67482 WP_003898819.1.67496 WP_003898819.1.67499 WP_003898819.1.67516 WP_003898819.1.67523 WP_003898819.1.67536 WP_003898819.1.67575 WP_003898819.1.67587 WP_003898819.1.67598 WP_003898819.1.67600 WP_003898819.1.67602 WP_003898819.1.67630 WP_003898819.1.67679 WP_003898819.1.67692 WP_003898819.1.67744 WP_003898819.1.6775 WP_003898819.1.6777 WP_003898819.1.67809 WP_003898819.1.67816 WP_003898819.1.67844 WP_003898819.1.67870 WP_003898819.1.67888 WP_003898819.1.67915 WP_003898819.1.67945 WP_003898819.1.67949 WP_003898819.1.67980 WP_003898819.1.67982 WP_003898819.1.68022 WP_003898819.1.68029 WP_003898819.1.68037 WP_003898819.1.68038 WP_003898819.1.68045 WP_003898819.1.68057 WP_003898819.1.68083 WP_003898819.1.68088 WP_003898819.1.68106 WP_003898819.1.68110 WP_003898819.1.68153 WP_003898819.1.68164 WP_003898819.1.68169 WP_003898819.1.68193 WP_003898819.1.68212 WP_003898819.1.68227 WP_003898819.1.68243 WP_003898819.1.6825 WP_003898819.1.68297 WP_003898819.1.68309 WP_003898819.1.68325 WP_003898819.1.68329 WP_003898819.1.68340 WP_003898819.1.68384 WP_003898819.1.68388 WP_003898819.1.68429 WP_003898819.1.6843 WP_003898819.1.68433 WP_003898819.1.68444 WP_003898819.1.68465 WP_003898819.1.68484 WP_003898819.1.68518 WP_003898819.1.68569 WP_003898819.1.68576 WP_003898819.1.68580 WP_003898819.1.68586 WP_003898819.1.68623 WP_003898819.1.68624 WP_003898819.1.68637 WP_003898819.1.68646 WP_003898819.1.68667 WP_003898819.1.68669 WP_003898819.1.68672 WP_003898819.1.68684 WP_003898819.1.68704 WP_003898819.1.68708 WP_003898819.1.6872 WP_003898819.1.68730 WP_003898819.1.68734 WP_003898819.1.68748 WP_003898819.1.68754 WP_003898819.1.6876 WP_003898819.1.68761 WP_003898819.1.68763 WP_003898819.1.68766 WP_003898819.1.68774 WP_003898819.1.68796 WP_003898819.1.68824 WP_003898819.1.68832 WP_003898819.1.68833 WP_003898819.1.68841 WP_003898819.1.68859 WP_003898819.1.68876 WP_003898819.1.68906 WP_003898819.1.68916 WP_003898819.1.68923 WP_003898819.1.68945 WP_003898819.1.6896 WP_003898819.1.68981 WP_003898819.1.68984 WP_003898819.1.68997 WP_003898819.1.69008 WP_003898819.1.69076 WP_003898819.1.69079 WP_003898819.1.6908 WP_003898819.1.69178 WP_003898819.1.69181 WP_003898819.1.69208 WP_003898819.1.69231 WP_003898819.1.69256 WP_003898819.1.69311 WP_003898819.1.69315 WP_003898819.1.69322 WP_003898819.1.69342 WP_003898819.1.6935 WP_003898819.1.6936 WP_003898819.1.69369 WP_003898819.1.69374 WP_003898819.1.69398 WP_003898819.1.69401 WP_003898819.1.69426 WP_003898819.1.69427 WP_003898819.1.69429 WP_003898819.1.6949 WP_003898819.1.6951 WP_003898819.1.69511 WP_003898819.1.69526 WP_003898819.1.69528 WP_003898819.1.69547 WP_003898819.1.69573 WP_003898819.1.69581 WP_003898819.1.6960 WP_003898819.1.69617 WP_003898819.1.69634 WP_003898819.1.69647 WP_003898819.1.69659 WP_003898819.1.69673 WP_003898819.1.69682 WP_003898819.1.69684 WP_003898819.1.69686 WP_003898819.1.69707 WP_003898819.1.69709 WP_003898819.1.69723 WP_003898819.1.69736 WP_003898819.1.69778 WP_003898819.1.69800 WP_003898819.1.69802 WP_003898819.1.69845 WP_003898819.1.69870 WP_003898819.1.69873 WP_003898819.1.69898 WP_003898819.1.69913 WP_003898819.1.69925 WP_003898819.1.69931 WP_003898819.1.69938 WP_003898819.1.69955 WP_003898819.1.69957 WP_003898819.1.69981 WP_003898819.1.69990 WP_003898819.1.70 WP_003898819.1.70000 WP_003898819.1.70017 WP_003898819.1.70032 WP_003898819.1.70055 WP_003898819.1.70062 WP_003898819.1.70072 WP_003898819.1.70131 WP_003898819.1.70132 WP_003898819.1.7022 WP_003898819.1.70227 WP_003898819.1.70255 WP_003898819.1.70271 WP_003898819.1.70274 WP_003898819.1.7029 WP_003898819.1.70325 WP_003898819.1.70328 WP_003898819.1.70356 WP_003898819.1.70364 WP_003898819.1.70368 WP_003898819.1.70369 WP_003898819.1.70418 WP_003898819.1.70422 WP_003898819.1.70435 WP_003898819.1.70444 WP_003898819.1.70463 WP_003898819.1.70471 WP_003898819.1.70480 WP_003898819.1.70494 WP_003898819.1.70498 WP_003898819.1.70505 WP_003898819.1.70525 WP_003898819.1.70573 WP_003898819.1.70577 WP_003898819.1.70615 WP_003898819.1.70618 WP_003898819.1.70622 WP_003898819.1.70626 WP_003898819.1.70668 WP_003898819.1.70699 WP_003898819.1.70704 WP_003898819.1.70729 WP_003898819.1.70757 WP_003898819.1.70782 WP_003898819.1.70796 WP_003898819.1.70830 WP_003898819.1.70834 WP_003898819.1.7084 WP_003898819.1.70840 WP_003898819.1.70864 WP_003898819.1.70871 WP_003898819.1.70955 WP_003898819.1.70958 WP_003898819.1.70964 WP_003898819.1.70976 WP_003898819.1.71015 WP_003898819.1.71063 WP_003898819.1.71076 WP_003898819.1.71083 WP_003898819.1.7111 WP_003898819.1.71118 WP_003898819.1.71128 WP_003898819.1.7113 WP_003898819.1.71187 WP_003898819.1.71191 WP_003898819.1.71255 WP_003898819.1.71258 WP_003898819.1.71259 WP_003898819.1.71289 WP_003898819.1.71326 WP_003898819.1.71329 WP_003898819.1.71331 WP_003898819.1.71344 WP_003898819.1.71390 WP_003898819.1.71399 WP_003898819.1.71414 WP_003898819.1.71440 WP_003898819.1.71457 WP_003898819.1.7146 WP_003898819.1.71464 WP_003898819.1.71490 WP_003898819.1.71492 WP_003898819.1.71509 WP_003898819.1.71516 WP_003898819.1.71517 WP_003898819.1.71527 WP_003898819.1.71532 WP_003898819.1.71545 WP_003898819.1.71546 WP_003898819.1.71569 WP_003898819.1.71604 WP_003898819.1.71621 WP_003898819.1.71630 WP_003898819.1.71638 WP_003898819.1.71654 WP_003898819.1.71664 WP_003898819.1.71665 WP_003898819.1.71683 WP_003898819.1.71701 WP_003898819.1.71718 WP_003898819.1.71731 WP_003898819.1.71778 WP_003898819.1.71781 WP_003898819.1.71803 WP_003898819.1.71820 WP_003898819.1.71847 WP_003898819.1.7185 WP_003898819.1.71851 WP_003898819.1.71871 WP_003898819.1.71909 WP_003898819.1.71957 WP_003898819.1.71970 WP_003898819.1.72047 WP_003898819.1.72061 WP_003898819.1.72062 WP_003898819.1.72072 WP_003898819.1.72111 WP_003898819.1.72122 WP_003898819.1.72128 WP_003898819.1.72143 WP_003898819.1.7216 WP_003898819.1.72168 WP_003898819.1.72179 WP_003898819.1.72209 WP_003898819.1.72218 WP_003898819.1.72219 WP_003898819.1.72227 WP_003898819.1.7224 WP_003898819.1.72268 WP_003898819.1.72332 WP_003898819.1.72380 WP_003898819.1.72401 WP_003898819.1.72405 WP_003898819.1.72420 WP_003898819.1.72441 WP_003898819.1.72451 WP_003898819.1.72452 WP_003898819.1.72457 WP_003898819.1.72460 WP_003898819.1.72466 WP_003898819.1.72487 WP_003898819.1.72488 WP_003898819.1.72492 WP_003898819.1.72506 WP_003898819.1.72543 WP_003898819.1.7256 WP_003898819.1.72576 WP_003898819.1.72578 WP_003898819.1.72585 WP_003898819.1.72591 WP_003898819.1.72592 WP_003898819.1.72640 WP_003898819.1.7266 WP_003898819.1.72661 WP_003898819.1.72739 WP_003898819.1.72744 WP_003898819.1.72755 WP_003898819.1.72759 WP_003898819.1.72784 WP_003898819.1.72792 WP_003898819.1.72826 WP_003898819.1.72831 WP_003898819.1.72852 WP_003898819.1.72853 WP_003898819.1.72879 WP_003898819.1.72880 WP_003898819.1.72938 WP_003898819.1.72954 WP_003898819.1.72957 WP_003898819.1.72959 WP_003898819.1.72973 WP_003898819.1.7298 WP_003898819.1.72982 WP_003898819.1.72988 WP_003898819.1.72993 WP_003898819.1.73006 WP_003898819.1.73013 WP_003898819.1.73025 WP_003898819.1.73028 WP_003898819.1.73042 WP_003898819.1.73045 WP_003898819.1.73118 WP_003898819.1.7312 WP_003898819.1.73127 WP_003898819.1.73134 WP_003898819.1.73150 WP_003898819.1.73154 WP_003898819.1.73163 WP_003898819.1.73182 WP_003898819.1.73205 WP_003898819.1.7321 WP_003898819.1.73310 WP_003898819.1.73315 WP_003898819.1.73365 WP_003898819.1.73391 WP_003898819.1.73404 WP_003898819.1.73424 WP_003898819.1.73436 WP_003898819.1.73445 WP_003898819.1.73453 WP_003898819.1.73465 WP_003898819.1.73466 WP_003898819.1.73470 WP_003898819.1.73471 WP_003898819.1.73478 WP_003898819.1.73482 WP_003898819.1.73507 WP_003898819.1.73532 WP_003898819.1.73550 WP_003898819.1.73564 WP_003898819.1.73623 WP_003898819.1.73629 WP_003898819.1.73644 WP_003898819.1.7366 WP_003898819.1.73661 WP_003898819.1.7368 WP_003898819.1.73688 WP_003898819.1.73723 WP_003898819.1.73744 WP_003898819.1.73750 WP_003898819.1.73760 WP_003898819.1.73774 WP_003898819.1.7379 WP_003898819.1.73813 WP_003898819.1.73840 WP_003898819.1.73876 WP_003898819.1.7389 WP_003898819.1.73986 WP_003898819.1.74016 WP_003898819.1.74039 WP_003898819.1.74101 WP_003898819.1.74107 WP_003898819.1.74129 WP_003898819.1.74144 WP_003898819.1.7417 WP_003898819.1.74190 WP_003898819.1.74210 WP_003898819.1.7423 WP_003898819.1.74259 WP_003898819.1.74262 WP_003898819.1.74269 WP_003898819.1.74282 WP_003898819.1.74291 WP_003898819.1.74296 WP_003898819.1.74304 WP_003898819.1.7432 WP_003898819.1.74347 WP_003898819.1.7436 WP_003898819.1.74378 WP_003898819.1.74382 WP_003898819.1.74395 WP_003898819.1.74400 WP_003898819.1.74401 WP_003898819.1.74432 WP_003898819.1.74442 WP_003898819.1.74477 WP_003898819.1.74487 WP_003898819.1.74499 WP_003898819.1.74504 WP_003898819.1.74511 WP_003898819.1.74523 WP_003898819.1.74525 WP_003898819.1.74551 WP_003898819.1.74555 WP_003898819.1.74628 WP_003898819.1.74653 WP_003898819.1.74660 WP_003898819.1.74683 WP_003898819.1.7469 WP_003898819.1.74725 WP_003898819.1.74760 WP_003898819.1.74809 WP_003898819.1.74820 WP_003898819.1.74870 WP_003898819.1.74881 WP_003898819.1.74888 WP_003898819.1.74952 WP_003898819.1.7496 WP_003898819.1.74988 WP_003898819.1.75043 WP_003898819.1.75045 WP_003898819.1.75055 WP_003898819.1.75078 WP_003898819.1.75081 WP_003898819.1.75120 WP_003898819.1.75163 WP_003898819.1.75188 WP_003898819.1.75200 WP_003898819.1.75202 WP_003898819.1.75234 WP_003898819.1.75239 WP_003898819.1.75250 WP_003898819.1.75263 WP_003898819.1.75281 WP_003898819.1.75342 WP_003898819.1.7535 WP_003898819.1.75376 WP_003898819.1.75391 WP_003898819.1.75395 WP_003898819.1.75441 WP_003898819.1.75510 WP_003898819.1.75581 WP_003898819.1.75598 WP_003898819.1.75645 WP_003898819.1.75665 WP_003898819.1.75671 WP_003898819.1.75749 WP_003898819.1.75772 WP_003898819.1.75774 WP_003898819.1.75811 WP_003898819.1.75833 WP_003898819.1.7585 WP_003898819.1.75864 WP_003898819.1.75868 WP_003898819.1.75878 WP_003898819.1.75927 WP_003898819.1.75946 WP_003898819.1.75968 WP_003898819.1.75974 WP_003898819.1.76007 WP_003898819.1.76016 WP_003898819.1.76032 WP_003898819.1.76037 WP_003898819.1.7604 WP_003898819.1.76045 WP_003898819.1.76052 WP_003898819.1.76058 WP_003898819.1.76064 WP_003898819.1.76110 WP_003898819.1.76126 WP_003898819.1.76133 WP_003898819.1.76138 WP_003898819.1.76157 WP_003898819.1.76172 WP_003898819.1.76177 WP_003898819.1.76183 WP_003898819.1.76209 WP_003898819.1.76272 WP_003898819.1.76277 WP_003898819.1.76280 WP_003898819.1.76281 WP_003898819.1.76291 WP_003898819.1.76297 WP_003898819.1.76360 WP_003898819.1.76403 WP_003898819.1.76413 WP_003898819.1.76414 WP_003898819.1.76427 WP_003898819.1.76436 WP_003898819.1.76442 WP_003898819.1.76443 WP_003898819.1.76456 WP_003898819.1.76521 WP_003898819.1.76533 WP_003898819.1.76616 WP_003898819.1.76625 WP_003898819.1.76629 WP_003898819.1.76635 WP_003898819.1.76638 WP_003898819.1.76639 WP_003898819.1.76640 WP_003898819.1.76644 WP_003898819.1.76677 WP_003898819.1.76678 WP_003898819.1.76679 WP_003898819.1.76734 WP_003898819.1.76744 WP_003898819.1.76750 WP_003898819.1.76754 WP_003898819.1.76757 WP_003898819.1.76781 WP_003898819.1.76818 WP_003898819.1.76824 WP_003898819.1.76835 WP_003898819.1.76873 WP_003898819.1.76881 WP_003898819.1.76888 WP_003898819.1.76900 WP_003898819.1.7691 WP_003898819.1.76947 WP_003898819.1.76954 WP_003898819.1.76955 WP_003898819.1.76963 WP_003898819.1.76976 WP_003898819.1.770 WP_003898819.1.77000 WP_003898819.1.77008 WP_003898819.1.77021 WP_003898819.1.77056 WP_003898819.1.77065 WP_003898819.1.77075 WP_003898819.1.77093 WP_003898819.1.77107 WP_003898819.1.77115 WP_003898819.1.77118 WP_003898819.1.77125 WP_003898819.1.77142 WP_003898819.1.77166 WP_003898819.1.77250 WP_003898819.1.77252 WP_003898819.1.77260 WP_003898819.1.77266 WP_003898819.1.77280 WP_003898819.1.77285 WP_003898819.1.77312 WP_003898819.1.77348 WP_003898819.1.77351 WP_003898819.1.77352 WP_003898819.1.77361 WP_003898819.1.774 WP_003898819.1.7740 WP_003898819.1.77404 WP_003898819.1.77425 WP_003898819.1.77463 WP_003898819.1.77474 WP_003898819.1.7748 WP_003898819.1.77484 WP_003898819.1.77491 WP_003898819.1.77499 WP_003898819.1.77510 WP_003898819.1.77530 WP_003898819.1.77554 WP_003898819.1.77559 WP_003898819.1.77599 WP_003898819.1.77605 WP_003898819.1.7762 WP_003898819.1.77627 WP_003898819.1.77649 WP_003898819.1.77654 WP_003898819.1.7766 WP_003898819.1.77667 WP_003898819.1.77704 WP_003898819.1.77706 WP_003898819.1.77726 WP_003898819.1.77774 WP_003898819.1.7778 WP_003898819.1.77790 WP_003898819.1.77809 WP_003898819.1.77820 WP_003898819.1.77843 WP_003898819.1.77855 WP_003898819.1.77865 WP_003898819.1.77868 WP_003898819.1.77879 WP_003898819.1.77890 WP_003898819.1.77909 WP_003898819.1.77911 WP_003898819.1.77931 WP_003898819.1.77984 WP_003898819.1.78020 WP_003898819.1.78024 WP_003898819.1.78075 WP_003898819.1.78084 WP_003898819.1.78086 WP_003898819.1.7809 WP_003898819.1.78098 WP_003898819.1.78105 WP_003898819.1.78113 WP_003898819.1.78136 WP_003898819.1.78162 WP_003898819.1.7817 WP_003898819.1.78200 WP_003898819.1.78216 WP_003898819.1.78236 WP_003898819.1.78238 WP_003898819.1.78322 WP_003898819.1.78338 WP_003898819.1.7836 WP_003898819.1.78360 WP_003898819.1.78386 WP_003898819.1.78429 WP_003898819.1.78435 WP_003898819.1.7844 WP_003898819.1.78459 WP_003898819.1.78488 WP_003898819.1.7849 WP_003898819.1.78499 WP_003898819.1.785 WP_003898819.1.78516 WP_003898819.1.78524 WP_003898819.1.78526 WP_003898819.1.78544 WP_003898819.1.78545 WP_003898819.1.78547 WP_003898819.1.78574 WP_003898819.1.78580 WP_003898819.1.7860 WP_003898819.1.78620 WP_003898819.1.78646 WP_003898819.1.78648 WP_003898819.1.78649 WP_003898819.1.78655 WP_003898819.1.78657 WP_003898819.1.78659 WP_003898819.1.7869 WP_003898819.1.78692 WP_003898819.1.78760 WP_003898819.1.78766 WP_003898819.1.78776 WP_003898819.1.78778 WP_003898819.1.78784 WP_003898819.1.78788 WP_003898819.1.78790 WP_003898819.1.78793 WP_003898819.1.78848 WP_003898819.1.78860 WP_003898819.1.7887 WP_003898819.1.78884 WP_003898819.1.78932 WP_003898819.1.78969 WP_003898819.1.78977 WP_003898819.1.78980 WP_003898819.1.79005 WP_003898819.1.79016 WP_003898819.1.79033 WP_003898819.1.79064 WP_003898819.1.79066 WP_003898819.1.79068 WP_003898819.1.79095 WP_003898819.1.79112 WP_003898819.1.79122 WP_003898819.1.79145 WP_003898819.1.79152 WP_003898819.1.79163 WP_003898819.1.79182 WP_003898819.1.79198 WP_003898819.1.79213 WP_003898819.1.79218 WP_003898819.1.79268 WP_003898819.1.79273 WP_003898819.1.79278 WP_003898819.1.79290 WP_003898819.1.79319 WP_003898819.1.7933 WP_003898819.1.79330 WP_003898819.1.79339 WP_003898819.1.79394 WP_003898819.1.79399 WP_003898819.1.79413 WP_003898819.1.79422 WP_003898819.1.79445 WP_003898819.1.79455 WP_003898819.1.79471 WP_003898819.1.79480 WP_003898819.1.79482 WP_003898819.1.79488 WP_003898819.1.79500 WP_003898819.1.79502 WP_003898819.1.79508 WP_003898819.1.79514 WP_003898819.1.79561 WP_003898819.1.79565 WP_003898819.1.79578 WP_003898819.1.79588 WP_003898819.1.79598 WP_003898819.1.79615 WP_003898819.1.79684 WP_003898819.1.79698 WP_003898819.1.797 WP_003898819.1.79744 WP_003898819.1.79784 WP_003898819.1.79802 WP_003898819.1.79806 WP_003898819.1.79819 WP_003898819.1.79826 WP_003898819.1.79828 WP_003898819.1.79851 WP_003898819.1.79853 WP_003898819.1.79863 WP_003898819.1.79881 WP_003898819.1.79885 WP_003898819.1.79898 WP_003898819.1.7990 WP_003898819.1.79900 WP_003898819.1.79913 WP_003898819.1.79918 WP_003898819.1.79947 WP_003898819.1.79948 WP_003898819.1.7995 WP_003898819.1.7997 WP_003898819.1.80004 WP_003898819.1.80015 WP_003898819.1.80022 WP_003898819.1.80030 WP_003898819.1.80054 WP_003898819.1.80099 WP_003898819.1.80129 WP_003898819.1.80177 WP_003898819.1.80234 WP_003898819.1.8026 WP_003898819.1.80275 WP_003898819.1.8029 WP_003898819.1.80299 WP_003898819.1.80300 WP_003898819.1.80304 WP_003898819.1.80326 WP_003898819.1.80351 WP_003898819.1.8037 WP_003898819.1.80370 WP_003898819.1.8044 WP_003898819.1.80451 WP_003898819.1.80458 WP_003898819.1.80461 WP_003898819.1.80490 WP_003898819.1.80503 WP_003898819.1.80552 WP_003898819.1.80576 WP_003898819.1.80588 WP_003898819.1.80599 WP_003898819.1.8060 WP_003898819.1.80624 WP_003898819.1.80636 WP_003898819.1.80669 WP_003898819.1.80673 WP_003898819.1.80711 WP_003898819.1.80714 WP_003898819.1.80743 WP_003898819.1.80784 WP_003898819.1.80815 WP_003898819.1.80853 WP_003898819.1.80918 WP_003898819.1.8093 WP_003898819.1.80967 WP_003898819.1.8097 WP_003898819.1.80988 WP_003898819.1.81007 WP_003898819.1.81013 WP_003898819.1.8105 WP_003898819.1.81059 WP_003898819.1.81063 WP_003898819.1.81066 WP_003898819.1.81075 WP_003898819.1.81091 WP_003898819.1.81119 WP_003898819.1.81125 WP_003898819.1.81136 WP_003898819.1.8114 WP_003898819.1.81189 WP_003898819.1.81192 WP_003898819.1.812 WP_003898819.1.81230 WP_003898819.1.81249 WP_003898819.1.81250 WP_003898819.1.81264 WP_003898819.1.8128 WP_003898819.1.81287 WP_003898819.1.81297 WP_003898819.1.8138 WP_003898819.1.81407 WP_003898819.1.8143 WP_003898819.1.81439 WP_003898819.1.81465 WP_003898819.1.81505 WP_003898819.1.81529 WP_003898819.1.81538 WP_003898819.1.81541 WP_003898819.1.81560 WP_003898819.1.81561 WP_003898819.1.81567 WP_003898819.1.81583 WP_003898819.1.81686 WP_003898819.1.81712 WP_003898819.1.81720 WP_003898819.1.81731 WP_003898819.1.81774 WP_003898819.1.81788 WP_003898819.1.81809 WP_003898819.1.81820 WP_003898819.1.81850 WP_003898819.1.81883 WP_003898819.1.81891 WP_003898819.1.81911 WP_003898819.1.81918 WP_003898819.1.82011 WP_003898819.1.82048 WP_003898819.1.82071 WP_003898819.1.82108 WP_003898819.1.82136 WP_003898819.1.82142 WP_003898819.1.8215 WP_003898819.1.82158 WP_003898819.1.8217 WP_003898819.1.82209 WP_003898819.1.82228 WP_003898819.1.82236 WP_003898819.1.82251 WP_003898819.1.82271 WP_003898819.1.82305 WP_003898819.1.82307 WP_003898819.1.82309 WP_003898819.1.82317 WP_003898819.1.8232 WP_003898819.1.82374 WP_003898819.1.82385 WP_003898819.1.82429 WP_003898819.1.82460 WP_003898819.1.82462 WP_003898819.1.82483 WP_003898819.1.82494 WP_003898819.1.82531 WP_003898819.1.82546 WP_003898819.1.82547 WP_003898819.1.82549 WP_003898819.1.82577 WP_003898819.1.82592 WP_003898819.1.82597 WP_003898819.1.82598 WP_003898819.1.82625 WP_003898819.1.82642 WP_003898819.1.82651 WP_003898819.1.82653 WP_003898819.1.82681 WP_003898819.1.82685 WP_003898819.1.8271 WP_003898819.1.82712 WP_003898819.1.8273 WP_003898819.1.82743 WP_003898819.1.82757 WP_003898819.1.82774 WP_003898819.1.82803 WP_003898819.1.82836 WP_003898819.1.82860 WP_003898819.1.82871 WP_003898819.1.82892 WP_003898819.1.82935 WP_003898819.1.82957 WP_003898819.1.82973 WP_003898819.1.82981 WP_003898819.1.82983 WP_003898819.1.83004 WP_003898819.1.83009 WP_003898819.1.83044 WP_003898819.1.83065 WP_003898819.1.83074 WP_003898819.1.83110 WP_003898819.1.83146 WP_003898819.1.83149 WP_003898819.1.83159 WP_003898819.1.8317 WP_003898819.1.83173 WP_003898819.1.83181 WP_003898819.1.83182 WP_003898819.1.83191 WP_003898819.1.83197 WP_003898819.1.83212 WP_003898819.1.8326 WP_003898819.1.83262 WP_003898819.1.83268 WP_003898819.1.83309 WP_003898819.1.83332 WP_003898819.1.83334 WP_003898819.1.83341 WP_003898819.1.83349 WP_003898819.1.8335 WP_003898819.1.83353 WP_003898819.1.83367 WP_003898819.1.83380 WP_003898819.1.83381 WP_003898819.1.83389 WP_003898819.1.83408 WP_003898819.1.83409 WP_003898819.1.83435 WP_003898819.1.83470 WP_003898819.1.83524 WP_003898819.1.83526 WP_003898819.1.8358 WP_003898819.1.83589 WP_003898819.1.83601 WP_003898819.1.83611 WP_003898819.1.83638 WP_003898819.1.83648 WP_003898819.1.83656 WP_003898819.1.83667 WP_003898819.1.83689 WP_003898819.1.83692 WP_003898819.1.83766 WP_003898819.1.83793 WP_003898819.1.83794 WP_003898819.1.83802 WP_003898819.1.83839 WP_003898819.1.83842 WP_003898819.1.83850 WP_003898819.1.83884 WP_003898819.1.83920 WP_003898819.1.83929 WP_003898819.1.83930 WP_003898819.1.83975 WP_003898819.1.83991 WP_003898819.1.8400 WP_003898819.1.84027 WP_003898819.1.8404 WP_003898819.1.84057 WP_003898819.1.84070 WP_003898819.1.8409 WP_003898819.1.84112 WP_003898819.1.84146 WP_003898819.1.8415 WP_003898819.1.84176 WP_003898819.1.84186 WP_003898819.1.84192 WP_003898819.1.84228 WP_003898819.1.8424 WP_003898819.1.84244 WP_003898819.1.84259 WP_003898819.1.8426 WP_003898819.1.84277 WP_003898819.1.84287 WP_003898819.1.8434 WP_003898819.1.84388 WP_003898819.1.84408 WP_003898819.1.84409 WP_003898819.1.84438 WP_003898819.1.84460 WP_003898819.1.84488 WP_003898819.1.84504 WP_003898819.1.84620 WP_003898819.1.84623 WP_003898819.1.84641 WP_003898819.1.84655 WP_003898819.1.84666 WP_003898819.1.84670 WP_003898819.1.84739 WP_003898819.1.84748 WP_003898819.1.84766 WP_003898819.1.84772 WP_003898819.1.84774 WP_003898819.1.848 WP_003898819.1.84812 WP_003898819.1.84836 WP_003898819.1.84839 WP_003898819.1.84846 WP_003898819.1.84873 WP_003898819.1.84911 WP_003898819.1.84938 WP_003898819.1.84968 WP_003898819.1.84973 WP_003898819.1.84981 WP_003898819.1.84985 WP_003898819.1.8503 WP_003898819.1.85038 WP_003898819.1.85041 WP_003898819.1.85043 WP_003898819.1.8505 WP_003898819.1.85074 WP_003898819.1.8509 WP_003898819.1.8512 WP_003898819.1.85148 WP_003898819.1.8518 WP_003898819.1.8522 WP_003898819.1.85242 WP_003898819.1.85281 WP_003898819.1.85284 WP_003898819.1.85314 WP_003898819.1.85319 WP_003898819.1.85330 WP_003898819.1.85341 WP_003898819.1.85346 WP_003898819.1.8535 WP_003898819.1.85363 WP_003898819.1.85371 WP_003898819.1.85377 WP_003898819.1.85387 WP_003898819.1.85399 WP_003898819.1.85458 WP_003898819.1.8546 WP_003898819.1.85464 WP_003898819.1.85478 WP_003898819.1.85480 WP_003898819.1.85488 WP_003898819.1.85495 WP_003898819.1.85551 WP_003898819.1.85557 WP_003898819.1.85577 WP_003898819.1.85597 WP_003898819.1.85599 WP_003898819.1.85610 WP_003898819.1.8563 WP_003898819.1.85679 WP_003898819.1.85704 WP_003898819.1.85737 WP_003898819.1.85763 WP_003898819.1.85808 WP_003898819.1.85819 WP_003898819.1.85820 WP_003898819.1.85823 WP_003898819.1.85832 WP_003898819.1.8586 WP_003898819.1.85872 WP_003898819.1.85894 WP_003898819.1.85909 WP_003898819.1.85913 WP_003898819.1.85953 WP_003898819.1.85986 WP_003898819.1.86000 WP_003898819.1.86024 WP_003898819.1.86025 WP_003898819.1.86032 WP_003898819.1.86048 WP_003898819.1.86052 WP_003898819.1.86067 WP_003898819.1.86103 WP_003898819.1.86122 WP_003898819.1.86124 WP_003898819.1.86160 WP_003898819.1.86164 WP_003898819.1.86168 WP_003898819.1.86190 WP_003898819.1.86204 WP_003898819.1.86208 WP_003898819.1.86235 WP_003898819.1.86249 WP_003898819.1.86260 WP_003898819.1.86290 WP_003898819.1.863 WP_003898819.1.86327 WP_003898819.1.86334 WP_003898819.1.86337 WP_003898819.1.86368 WP_003898819.1.86377 WP_003898819.1.86425 WP_003898819.1.86459 WP_003898819.1.8649 WP_003898819.1.86499 WP_003898819.1.86520 WP_003898819.1.86561 WP_003898819.1.86568 WP_003898819.1.86575 WP_003898819.1.86584 WP_003898819.1.86605 WP_003898819.1.86626 WP_003898819.1.86648 WP_003898819.1.8666 WP_003898819.1.86684 WP_003898819.1.86696 WP_003898819.1.86705 WP_003898819.1.86718 WP_003898819.1.86725 WP_003898819.1.86757 WP_003898819.1.86766 WP_003898819.1.86801 WP_003898819.1.86814 WP_003898819.1.86820 WP_003898819.1.86825 WP_003898819.1.86834 WP_003898819.1.8685 WP_003898819.1.86851 WP_003898819.1.86855 WP_003898819.1.86867 WP_003898819.1.86877 WP_003898819.1.86883 WP_003898819.1.8689 WP_003898819.1.86892 WP_003898819.1.86933 WP_003898819.1.86941 WP_003898819.1.86950 WP_003898819.1.86962 WP_003898819.1.86963 WP_003898819.1.86979 WP_003898819.1.8700 WP_003898819.1.87001 WP_003898819.1.87002 WP_003898819.1.87031 WP_003898819.1.87116 WP_003898819.1.87117 WP_003898819.1.8714 WP_003898819.1.87162 WP_003898819.1.87178 WP_003898819.1.87191 WP_003898819.1.87201 WP_003898819.1.87209 WP_003898819.1.87240 WP_003898819.1.87266 WP_003898819.1.87273 WP_003898819.1.87275 WP_003898819.1.8733 WP_003898819.1.87345 WP_003898819.1.87369 WP_003898819.1.8737 WP_003898819.1.87401 WP_003898819.1.87404 WP_003898819.1.87406 WP_003898819.1.87409 WP_003898819.1.87444 WP_003898819.1.87446 WP_003898819.1.87459 WP_003898819.1.87472 WP_003898819.1.87489 WP_003898819.1.87494 WP_003898819.1.87496 WP_003898819.1.87582 WP_003898819.1.87588 WP_003898819.1.87617 WP_003898819.1.87619 WP_003898819.1.87620 WP_003898819.1.87634 WP_003898819.1.87643 WP_003898819.1.8765 WP_003898819.1.87654 WP_003898819.1.87658 WP_003898819.1.87665 WP_003898819.1.87676 WP_003898819.1.87677 WP_003898819.1.87684 WP_003898819.1.87692 WP_003898819.1.87707 WP_003898819.1.87732 WP_003898819.1.87784 WP_003898819.1.87796 WP_003898819.1.87809 WP_003898819.1.87817 WP_003898819.1.87827 WP_003898819.1.87831 WP_003898819.1.87835 WP_003898819.1.87837 WP_003898819.1.87866 WP_003898819.1.8789 WP_003898819.1.87911 WP_003898819.1.87924 WP_003898819.1.87951 WP_003898819.1.87955 WP_003898819.1.87956 WP_003898819.1.87991 WP_003898819.1.88 WP_003898819.1.88037 WP_003898819.1.88039 WP_003898819.1.88072 WP_003898819.1.88077 WP_003898819.1.88121 WP_003898819.1.88180 WP_003898819.1.88191 WP_003898819.1.88205 WP_003898819.1.88217 WP_003898819.1.88219 WP_003898819.1.88245 WP_003898819.1.88253 WP_003898819.1.88294 WP_003898819.1.88315 WP_003898819.1.88316 WP_003898819.1.88320 WP_003898819.1.88338 WP_003898819.1.8840 WP_003898819.1.88437 WP_003898819.1.88453 WP_003898819.1.88469 WP_003898819.1.88489 WP_003898819.1.88507 WP_003898819.1.88521 WP_003898819.1.88530 WP_003898819.1.88537 WP_003898819.1.88541 WP_003898819.1.88592 WP_003898819.1.88616 WP_003898819.1.88618 WP_003898819.1.8862 WP_003898819.1.88625 WP_003898819.1.88632 WP_003898819.1.88634 WP_003898819.1.88649 WP_003898819.1.8870 WP_003898819.1.88737 WP_003898819.1.88756 WP_003898819.1.888 WP_003898819.1.88824 WP_003898819.1.88886 WP_003898819.1.88965 WP_003898819.1.88985 WP_003898819.1.8902 WP_003898819.1.89025 WP_003898819.1.89041 WP_003898819.1.89046 WP_003898819.1.89082 WP_003898819.1.89162 WP_003898819.1.89168 WP_003898819.1.8917 WP_003898819.1.89193 WP_003898819.1.89205 WP_003898819.1.89207 WP_003898819.1.89225 WP_003898819.1.8925 WP_003898819.1.89277 WP_003898819.1.89286 WP_003898819.1.89293 WP_003898819.1.8935 WP_003898819.1.89371 WP_003898819.1.89378 WP_003898819.1.89392 WP_003898819.1.89406 WP_003898819.1.8943 WP_003898819.1.89453 WP_003898819.1.89473 WP_003898819.1.89475 WP_003898819.1.89483 WP_003898819.1.895 WP_003898819.1.89513 WP_003898819.1.89517 WP_003898819.1.89522 WP_003898819.1.8954 WP_003898819.1.89543 WP_003898819.1.89567 WP_003898819.1.8957 WP_003898819.1.89572 WP_003898819.1.89589 WP_003898819.1.89607 WP_003898819.1.89613 WP_003898819.1.89625 WP_003898819.1.89648 WP_003898819.1.8967 WP_003898819.1.89670 WP_003898819.1.89676 WP_003898819.1.89729 WP_003898819.1.89739 WP_003898819.1.89762 WP_003898819.1.8977 WP_003898819.1.89802 WP_003898819.1.89808 WP_003898819.1.8982 WP_003898819.1.89829 WP_003898819.1.89831 WP_003898819.1.89844 WP_003898819.1.89849 WP_003898819.1.8989 WP_003898819.1.89901 WP_003898819.1.89903 WP_003898819.1.89909 WP_003898819.1.8992 WP_003898819.1.89922 WP_003898819.1.89926 WP_003898819.1.89963 WP_003898819.1.89971 WP_003898819.1.8998 WP_003898819.1.89987 WP_003898819.1.900 WP_003898819.1.90048 WP_003898819.1.9007 WP_003898819.1.90080 WP_003898819.1.90130 WP_003898819.1.90134 WP_003898819.1.90137 WP_003898819.1.90157 WP_003898819.1.90184 WP_003898819.1.90199 WP_003898819.1.90231 WP_003898819.1.90245 WP_003898819.1.90308 WP_003898819.1.90322 WP_003898819.1.90328 WP_003898819.1.90372 WP_003898819.1.90481 WP_003898819.1.90499 WP_003898819.1.9050 WP_003898819.1.90527 WP_003898819.1.90550 WP_003898819.1.90560 WP_003898819.1.90612 WP_003898819.1.90640 WP_003898819.1.90672 WP_003898819.1.90687 WP_003898819.1.90691 WP_003898819.1.90711 WP_003898819.1.90722 WP_003898819.1.90744 WP_003898819.1.9075 WP_003898819.1.90756 WP_003898819.1.90767 WP_003898819.1.90771 WP_003898819.1.90785 WP_003898819.1.90788 WP_003898819.1.90800 WP_003898819.1.90810 WP_003898819.1.90816 WP_003898819.1.90819 WP_003898819.1.9082 WP_003898819.1.90884 WP_003898819.1.90899 WP_003898819.1.90906 WP_003898819.1.90958 WP_003898819.1.90976 WP_003898819.1.90977 WP_003898819.1.90987 WP_003898819.1.9102 WP_003898819.1.91026 WP_003898819.1.91032 WP_003898819.1.91043 WP_003898819.1.91053 WP_003898819.1.91082 WP_003898819.1.91106 WP_003898819.1.91112 WP_003898819.1.91144 WP_003898819.1.91151 WP_003898819.1.91157 WP_003898819.1.91167 WP_003898819.1.91169 WP_003898819.1.91192 WP_003898819.1.91201 WP_003898819.1.91207 WP_003898819.1.91208 WP_003898819.1.91211 WP_003898819.1.91214 WP_003898819.1.91230 WP_003898819.1.91244 WP_003898819.1.91251 WP_003898819.1.91260 WP_003898819.1.91265 WP_003898819.1.9128 WP_003898819.1.91284 WP_003898819.1.91294 WP_003898819.1.91303 WP_003898819.1.91322 WP_003898819.1.91352 WP_003898819.1.91386 WP_003898819.1.9139 WP_003898819.1.91398 WP_003898819.1.91411 WP_003898819.1.91430 WP_003898819.1.91436 WP_003898819.1.91483 WP_003898819.1.91496 WP_003898819.1.91507 WP_003898819.1.91508 WP_003898819.1.91576 WP_003898819.1.91589 WP_003898819.1.91694 WP_003898819.1.91713 WP_003898819.1.91716 WP_003898819.1.91717 WP_003898819.1.91728 WP_003898819.1.91743 WP_003898819.1.91759 WP_003898819.1.91784 WP_003898819.1.91785 WP_003898819.1.91786 WP_003898819.1.91822 WP_003898819.1.91828 WP_003898819.1.9189 WP_003898819.1.91896 WP_003898819.1.9190 WP_003898819.1.91915 WP_003898819.1.91931 WP_003898819.1.91937 WP_003898819.1.91944 WP_003898819.1.91953 WP_003898819.1.91957 WP_003898819.1.91976 WP_003898819.1.92021 WP_003898819.1.92083 WP_003898819.1.92127 WP_003898819.1.92144 WP_003898819.1.92150 WP_003898819.1.92153 WP_003898819.1.92190 WP_003898819.1.92192 WP_003898819.1.92200 WP_003898819.1.92220 WP_003898819.1.92222 WP_003898819.1.92273 WP_003898819.1.92289 WP_003898819.1.9229 WP_003898819.1.92294 WP_003898819.1.92300 WP_003898819.1.92317 WP_003898819.1.92334 WP_003898819.1.92338 WP_003898819.1.92345 WP_003898819.1.92356 WP_003898819.1.92364 WP_003898819.1.92380 WP_003898819.1.92416 WP_003898819.1.92428 WP_003898819.1.92447 WP_003898819.1.92456 WP_003898819.1.92467 WP_003898819.1.92471 WP_003898819.1.92490 WP_003898819.1.92508 WP_003898819.1.9251 WP_003898819.1.92511 WP_003898819.1.92523 WP_003898819.1.92527 WP_003898819.1.92536 WP_003898819.1.92592 WP_003898819.1.92597 WP_003898819.1.92603 WP_003898819.1.92610 WP_003898819.1.92613 WP_003898819.1.9263 WP_003898819.1.9265 WP_003898819.1.92650 WP_003898819.1.92660 WP_003898819.1.92677 WP_003898819.1.92685 WP_003898819.1.92689 WP_003898819.1.92690 WP_003898819.1.92706 WP_003898819.1.92714 WP_003898819.1.92736 WP_003898819.1.9274 WP_003898819.1.92752 WP_003898819.1.92760 WP_003898819.1.92777 WP_003898819.1.92803 WP_003898819.1.92833 WP_003898819.1.92856 WP_003898819.1.92881 WP_003898819.1.92892 WP_003898819.1.92907 WP_003898819.1.92908 WP_003898819.1.9291 WP_003898819.1.92917 WP_003898819.1.92996 WP_003898819.1.93006 WP_003898819.1.93008 WP_003898819.1.93009 WP_003898819.1.93015 WP_003898819.1.93043 WP_003898819.1.9307 WP_003898819.1.93083 WP_003898819.1.93097 WP_003898819.1.93137 WP_003898819.1.93192 WP_003898819.1.93199 WP_003898819.1.93203 WP_003898819.1.93212 WP_003898819.1.93234 WP_003898819.1.93245 WP_003898819.1.93257 WP_003898819.1.93265 WP_003898819.1.93297 WP_003898819.1.93320 WP_003898819.1.93328 WP_003898819.1.93337 WP_003898819.1.93343 WP_003898819.1.93349 WP_003898819.1.93363 WP_003898819.1.93377 WP_003898819.1.9338 WP_003898819.1.93407 WP_003898819.1.93417 WP_003898819.1.93419 WP_003898819.1.93426 WP_003898819.1.9344 WP_003898819.1.93443 WP_003898819.1.93447 WP_003898819.1.93470 WP_003898819.1.93483 WP_003898819.1.93487 WP_003898819.1.93495 WP_003898819.1.93499 WP_003898819.1.93516 WP_003898819.1.93536 WP_003898819.1.93544 WP_003898819.1.93555 WP_003898819.1.93560 WP_003898819.1.93564 WP_003898819.1.9357 WP_003898819.1.93573 WP_003898819.1.93576 WP_003898819.1.93588 WP_003898819.1.9363 WP_003898819.1.93645 WP_003898819.1.93649 WP_003898819.1.93659 WP_003898819.1.93677 WP_003898819.1.9368 WP_003898819.1.93689 WP_003898819.1.93693 WP_003898819.1.93698 WP_003898819.1.9371 WP_003898819.1.93792 WP_003898819.1.93823 WP_003898819.1.93871 WP_003898819.1.9388 WP_003898819.1.93894 WP_003898819.1.93903 WP_003898819.1.93907 WP_003898819.1.93913 WP_003898819.1.93946 WP_003898819.1.93950 WP_003898819.1.93953 WP_003898819.1.93988 WP_003898819.1.9407 WP_003898819.1.94143 WP_003898819.1.94154 WP_003898819.1.94184 WP_003898819.1.94204 WP_003898819.1.94205 WP_003898819.1.94226 WP_003898819.1.94231 WP_003898819.1.94256 WP_003898819.1.94261 WP_003898819.1.94281 WP_003898819.1.94292 WP_003898819.1.94297 WP_003898819.1.9431 WP_003898819.1.94326 WP_003898819.1.94339 WP_003898819.1.94392 WP_003898819.1.94416 WP_003898819.1.94421 WP_003898819.1.94456 WP_003898819.1.94470 WP_003898819.1.94480 WP_003898819.1.94495 WP_003898819.1.94511 WP_003898819.1.94512 WP_003898819.1.94525 WP_003898819.1.94528 WP_003898819.1.94564 WP_003898819.1.946 WP_003898819.1.94602 WP_003898819.1.94623 WP_003898819.1.94629 WP_003898819.1.9465 WP_003898819.1.94673 WP_003898819.1.94714 WP_003898819.1.94730 WP_003898819.1.94736 WP_003898819.1.94776 WP_003898819.1.9478 WP_003898819.1.94834 WP_003898819.1.94852 WP_003898819.1.94872 WP_003898819.1.9488 WP_003898819.1.94902 WP_003898819.1.94916 WP_003898819.1.94979 WP_003898819.1.94994 WP_003898819.1.94996 WP_003898819.1.94998 WP_003898819.1.95007 WP_003898819.1.95010 WP_003898819.1.95015 WP_003898819.1.95034 WP_003898819.1.95068 WP_003898819.1.95081 WP_003898819.1.95082 WP_003898819.1.9509 WP_003898819.1.95096 WP_003898819.1.95112 WP_003898819.1.95138 WP_003898819.1.9514 WP_003898819.1.95179 WP_003898819.1.95188 WP_003898819.1.95190 WP_003898819.1.95234 WP_003898819.1.95241 WP_003898819.1.95245 WP_003898819.1.95257 WP_003898819.1.9531 WP_003898819.1.95335 WP_003898819.1.95344 WP_003898819.1.9535 WP_003898819.1.95370 WP_003898819.1.95392 WP_003898819.1.95416 WP_003898819.1.95417 WP_003898819.1.95454 WP_003898819.1.95455 WP_003898819.1.95491 WP_003898819.1.95497 WP_003898819.1.95508 WP_003898819.1.95509 WP_003898819.1.95529 WP_003898819.1.95556 WP_003898819.1.95565 WP_003898819.1.95578 WP_003898819.1.95580 WP_003898819.1.95585 WP_003898819.1.95679 WP_003898819.1.95685 WP_003898819.1.957 WP_003898819.1.95724 WP_003898819.1.95727 WP_003898819.1.95730 WP_003898819.1.95735 WP_003898819.1.95758 WP_003898819.1.95772 WP_003898819.1.95797 WP_003898819.1.95839 WP_003898819.1.9585 WP_003898819.1.9590 WP_003898819.1.95902 WP_003898819.1.95908 WP_003898819.1.95924 WP_003898819.1.95926 WP_003898819.1.95958 WP_003898819.1.95964 WP_003898819.1.95973 WP_003898819.1.96006 WP_003898819.1.9602 WP_003898819.1.96036 WP_003898819.1.96062 WP_003898819.1.96065 WP_003898819.1.96098 WP_003898819.1.96146 WP_003898819.1.96166 WP_003898819.1.96171 WP_003898819.1.96182 WP_003898819.1.96204 WP_003898819.1.96230 WP_003898819.1.96235 WP_003898819.1.96242 WP_003898819.1.96245 WP_003898819.1.96254 WP_003898819.1.96259 WP_003898819.1.96286 WP_003898819.1.96313 WP_003898819.1.96318 WP_003898819.1.96345 WP_003898819.1.96360 WP_003898819.1.96456 WP_003898819.1.96486 WP_003898819.1.96560 WP_003898819.1.96569 WP_003898819.1.96573 WP_003898819.1.96575 WP_003898819.1.96576 WP_003898819.1.96611 WP_003898819.1.96621 WP_003898819.1.9667 WP_003898819.1.96681 WP_003898819.1.96726 WP_003898819.1.96733 WP_003898819.1.96742 WP_003898819.1.96754 WP_003898819.1.9678 WP_003898819.1.9685 WP_003898819.1.97008 WP_003898819.1.97009 WP_003898819.1.97056 WP_003898819.1.97084 WP_003898819.1.97087 WP_003898819.1.97094 WP_003898819.1.97096 WP_003898819.1.97099 WP_003898819.1.97108 WP_003898819.1.97113 WP_003898819.1.97122 WP_003898819.1.97127 WP_003898819.1.97129 WP_003898819.1.97136 WP_003898819.1.9716 WP_003898819.1.97176 WP_003898819.1.97222 WP_003898819.1.97223 WP_003898819.1.97237 WP_003898819.1.97242 WP_003898819.1.97283 WP_003898819.1.97296 WP_003898819.1.97321 WP_003898819.1.97325 WP_003898819.1.97330 WP_003898819.1.97366 WP_003898819.1.97376 WP_003898819.1.97380 WP_003898819.1.9739 WP_003898819.1.97462 WP_003898819.1.97517 WP_003898819.1.97519 WP_003898819.1.97535 WP_003898819.1.97540 WP_003898819.1.97545 WP_003898819.1.97546 WP_003898819.1.97550 WP_003898819.1.97577 WP_003898819.1.97584 WP_003898819.1.9759 WP_003898819.1.97591 WP_003898819.1.97596 WP_003898819.1.97609 WP_003898819.1.97618 WP_003898819.1.9763 WP_003898819.1.97669 WP_003898819.1.97673 WP_003898819.1.97700 WP_003898819.1.97701 WP_003898819.1.9773 WP_003898819.1.97730 WP_003898819.1.97740 WP_003898819.1.97751 WP_003898819.1.97754 WP_003898819.1.97797 WP_003898819.1.9782 WP_003898819.1.9784 WP_003898819.1.9790 WP_003898819.1.9795 WP_003898819.1.97951 WP_003898819.1.97958 WP_003898819.1.97966 WP_003898819.1.97977 WP_003898819.1.97979 WP_003898819.1.97995 WP_003898819.1.98018 WP_003898819.1.98034 WP_003898819.1.98052 WP_003898819.1.98071 WP_003898819.1.98072 WP_003898819.1.98113 WP_003898819.1.98114 WP_003898819.1.98128 WP_003898819.1.98181 WP_003898819.1.98188 WP_003898819.1.98189 WP_003898819.1.98213 WP_003898819.1.98225 WP_003898819.1.98291 WP_003898819.1.98335 WP_003898819.1.98350 WP_003898819.1.98395 WP_003898819.1.98412 WP_003898819.1.98441 WP_003898819.1.98443 WP_003898819.1.98462 WP_003898819.1.9848 WP_003898819.1.98482 WP_003898819.1.98486 WP_003898819.1.98488 WP_003898819.1.98503 WP_003898819.1.98516 WP_003898819.1.98536 WP_003898819.1.98541 WP_003898819.1.98566 WP_003898819.1.98576 WP_003898819.1.98590 WP_003898819.1.98594 WP_003898819.1.98599 WP_003898819.1.98629 WP_003898819.1.98645 WP_003898819.1.98646 WP_003898819.1.98649 WP_003898819.1.98656 WP_003898819.1.9867 WP_003898819.1.98674 WP_003898819.1.98697 WP_003898819.1.98701 WP_003898819.1.98739 WP_003898819.1.98749 WP_003898819.1.98765 WP_003898819.1.98770 WP_003898819.1.98777 WP_003898819.1.98778 WP_003898819.1.98802 WP_003898819.1.98838 WP_003898819.1.98850 WP_003898819.1.98906 WP_003898819.1.98935 WP_003898819.1.98948 WP_003898819.1.98953 WP_003898819.1.98984 WP_003898819.1.99000 WP_003898819.1.99023 WP_003898819.1.99030 WP_003898819.1.99037 WP_003898819.1.99055 WP_003898819.1.99062 WP_003898819.1.99086 WP_003898819.1.99115 WP_003898819.1.99117 WP_003898819.1.99161 WP_003898819.1.99176 WP_003898819.1.99205 WP_003898819.1.99211 WP_003898819.1.99216 WP_003898819.1.99251 WP_003898819.1.99269 WP_003898819.1.99294 WP_003898819.1.99312 WP_003898819.1.99315 WP_003898819.1.99316 WP_003898819.1.99322 WP_003898819.1.99328 WP_003898819.1.99365 WP_003898819.1.99368 WP_003898819.1.99379 WP_003898819.1.99396 WP_003898819.1.99402 WP_003898819.1.99404 WP_003898819.1.99419 WP_003898819.1.99438 WP_003898819.1.99460 WP_003898819.1.99468 WP_003898819.1.99473 WP_003898819.1.99513 WP_003898819.1.99529 WP_003898819.1.99548 WP_003898819.1.99572 WP_003898819.1.99578 WP_003898819.1.99605 WP_003898819.1.99609 WP_003898819.1.99617 WP_003898819.1.99635 WP_003898819.1.99650 WP_003898819.1.99672 WP_003898819.1.99701 WP_003898819.1.99711 WP_003898819.1.99716 WP_003898819.1.99740 WP_003898819.1.99745 WP_003898819.1.99749 WP_003898819.1.99798 WP_003898819.1.99817 WP_003898819.1.99832 WP_003898819.1.99847 WP_003898819.1.99852 WP_003898819.1.99886 WP_003898819.1.99897 WP_003898819.1.99899 WP_003898819.1.99915 WP_003898819.1.9993 WP_003898819.1.99982 WP_003898819.1.99991 gi|479055271|ref|YP_007351077.1| gi|340626325|ref|YP_004744777.1| gi|386004297|ref|YP_005922576.1| gi|506925777|ref|YP_008006227.1| gi|383307179|ref|YP_005359990.1| gi|253799645|ref|YP_003032646.1| gi|148822527|ref|YP_001287281.1| gi|31792502|ref|NP_854995.1| gi|15840760|ref|NP_335797.1| gi|494695721|ref|YP_007961224.1| gi|433634373|ref|YP_007268000.1| gi|148661097|ref|YP_001282620.1| gi|378771072|ref|YP_005170805.1| gi|197740023|ref|YP_002161337.1| gi|449063380|ref|YP_007430463.1| gi|121637238|ref|YP_977461.1| gi|375296886|ref|YP_005101153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]