SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253800036|ref|YP_003033037.1| from Mycobacterium tuberculosis KZN 1435

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253800036|ref|YP_003033037.1|
Domain Number 1 Region: 1-261
Classification Level Classification E-value
Superfamily SPOC domain-like 4.32e-57
Family Ku70 subunit middle domain 0.089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|253800036|ref|YP_003033037.1|
Sequence length 273
Comment Ku protein [Mycobacterium tuberculosis KZN 1435]
Sequence
MRAIWTGSIAFGLVNVPVKVYSATADHDIRFHQVHAKDNGRIRYKRVCEACGEVVDYRDL
ARAYESGDGQMVAITDDDIASLPEERSREIEVLEFVPAADVDPMMFDRSYFLEPDSKSSK
SYVLLAKTLAETDRMAIVHFTLRNKTRLAALRVKDFGKREVMMVHTLLWPDEIRDPDFPV
LDQKVEIKPAELKMAGQVVDSMADDFNPDRYHDTYQEQLQELIDTKLEGGQAFTAEDQPR
LLDEPEDVSDLLAKLEASVKARSKANSNVPTPP
Download sequence
Identical sequences A0A045H5L4 A0A0H3M3K0 A0A109S6R5 A0A109SLJ0 A0A109SUX7 A0A197J1A5 A0A1A9E4I8 A0A1R3XWW4 A0A1S1BCU8 A5U0X7 F8M4I2 M8CQF8 O05866 P9WKD8 P9WKD9 R4MG44
gi|494695335|ref|YP_007960838.1| gi|339630999|ref|YP_004722641.1| gi|378770696|ref|YP_005170429.1| gi|224989333|ref|YP_002644020.1| gi|31792126|ref|NP_854619.1| gi|15608077|ref|NP_215452.1| gi|148822146|ref|YP_001286900.1| gi|253800036|ref|YP_003033037.1| gi|479313822|ref|YP_007853874.1| gi|375297273|ref|YP_005101540.1| NP_215452.1.84033 WP_003404795.1.100000 WP_003404795.1.100021 WP_003404795.1.100069 WP_003404795.1.100087 WP_003404795.1.10015 WP_003404795.1.100208 WP_003404795.1.100216 WP_003404795.1.100255 WP_003404795.1.100260 WP_003404795.1.100270 WP_003404795.1.100279 WP_003404795.1.100286 WP_003404795.1.100308 WP_003404795.1.100309 WP_003404795.1.100318 WP_003404795.1.100337 WP_003404795.1.100338 WP_003404795.1.10037 WP_003404795.1.100383 WP_003404795.1.100395 WP_003404795.1.100396 WP_003404795.1.1004 WP_003404795.1.100401 WP_003404795.1.100459 WP_003404795.1.100460 WP_003404795.1.100552 WP_003404795.1.100581 WP_003404795.1.100600 WP_003404795.1.100625 WP_003404795.1.10064 WP_003404795.1.100666 WP_003404795.1.100671 WP_003404795.1.100677 WP_003404795.1.100682 WP_003404795.1.100697 WP_003404795.1.100703 WP_003404795.1.100716 WP_003404795.1.100722 WP_003404795.1.100754 WP_003404795.1.100757 WP_003404795.1.100772 WP_003404795.1.1008 WP_003404795.1.100812 WP_003404795.1.100845 WP_003404795.1.100866 WP_003404795.1.10088 WP_003404795.1.100889 WP_003404795.1.10090 WP_003404795.1.100910 WP_003404795.1.100915 WP_003404795.1.100918 WP_003404795.1.100935 WP_003404795.1.100984 WP_003404795.1.100998 WP_003404795.1.101 WP_003404795.1.101025 WP_003404795.1.101028 WP_003404795.1.10104 WP_003404795.1.101048 WP_003404795.1.101054 WP_003404795.1.101075 WP_003404795.1.101143 WP_003404795.1.101146 WP_003404795.1.10116 WP_003404795.1.10117 WP_003404795.1.101209 WP_003404795.1.10125 WP_003404795.1.101290 WP_003404795.1.101323 WP_003404795.1.101324 WP_003404795.1.101350 WP_003404795.1.101367 WP_003404795.1.101398 WP_003404795.1.101403 WP_003404795.1.101421 WP_003404795.1.10144 WP_003404795.1.101442 WP_003404795.1.10145 WP_003404795.1.101452 WP_003404795.1.101456 WP_003404795.1.101481 WP_003404795.1.101493 WP_003404795.1.101496 WP_003404795.1.101525 WP_003404795.1.101533 WP_003404795.1.101535 WP_003404795.1.101553 WP_003404795.1.101558 WP_003404795.1.10156 WP_003404795.1.101573 WP_003404795.1.101576 WP_003404795.1.10159 WP_003404795.1.101592 WP_003404795.1.101604 WP_003404795.1.101607 WP_003404795.1.101622 WP_003404795.1.101644 WP_003404795.1.101659 WP_003404795.1.101671 WP_003404795.1.101687 WP_003404795.1.101698 WP_003404795.1.10170 WP_003404795.1.101713 WP_003404795.1.101722 WP_003404795.1.101733 WP_003404795.1.101743 WP_003404795.1.101753 WP_003404795.1.101754 WP_003404795.1.101764 WP_003404795.1.101773 WP_003404795.1.101795 WP_003404795.1.101797 WP_003404795.1.101798 WP_003404795.1.101802 WP_003404795.1.101826 WP_003404795.1.101836 WP_003404795.1.101858 WP_003404795.1.101859 WP_003404795.1.101862 WP_003404795.1.101888 WP_003404795.1.101894 WP_003404795.1.101899 WP_003404795.1.1019 WP_003404795.1.101923 WP_003404795.1.101925 WP_003404795.1.10193 WP_003404795.1.101996 WP_003404795.1.102 WP_003404795.1.102008 WP_003404795.1.102017 WP_003404795.1.102053 WP_003404795.1.102055 WP_003404795.1.102063 WP_003404795.1.102099 WP_003404795.1.1021 WP_003404795.1.10211 WP_003404795.1.102119 WP_003404795.1.102121 WP_003404795.1.102143 WP_003404795.1.10216 WP_003404795.1.10224 WP_003404795.1.10253 WP_003404795.1.10262 WP_003404795.1.10272 WP_003404795.1.10277 WP_003404795.1.1033 WP_003404795.1.10350 WP_003404795.1.10362 WP_003404795.1.10366 WP_003404795.1.10376 WP_003404795.1.10396 WP_003404795.1.10410 WP_003404795.1.10414 WP_003404795.1.10421 WP_003404795.1.10430 WP_003404795.1.1044 WP_003404795.1.10440 WP_003404795.1.10445 WP_003404795.1.10471 WP_003404795.1.10472 WP_003404795.1.10489 WP_003404795.1.105 WP_003404795.1.10518 WP_003404795.1.10523 WP_003404795.1.10545 WP_003404795.1.1057 WP_003404795.1.10594 WP_003404795.1.10603 WP_003404795.1.10606 WP_003404795.1.10615 WP_003404795.1.10623 WP_003404795.1.10635 WP_003404795.1.10643 WP_003404795.1.10648 WP_003404795.1.10662 WP_003404795.1.10709 WP_003404795.1.10735 WP_003404795.1.10740 WP_003404795.1.10756 WP_003404795.1.1078 WP_003404795.1.10791 WP_003404795.1.10799 WP_003404795.1.10825 WP_003404795.1.10848 WP_003404795.1.10863 WP_003404795.1.10879 WP_003404795.1.10912 WP_003404795.1.10916 WP_003404795.1.10923 WP_003404795.1.10927 WP_003404795.1.1095 WP_003404795.1.10956 WP_003404795.1.10958 WP_003404795.1.10962 WP_003404795.1.10980 WP_003404795.1.10993 WP_003404795.1.1100 WP_003404795.1.11040 WP_003404795.1.11061 WP_003404795.1.11070 WP_003404795.1.11171 WP_003404795.1.11175 WP_003404795.1.11176 WP_003404795.1.11222 WP_003404795.1.11236 WP_003404795.1.11329 WP_003404795.1.1133 WP_003404795.1.11342 WP_003404795.1.11373 WP_003404795.1.11376 WP_003404795.1.11390 WP_003404795.1.11402 WP_003404795.1.11481 WP_003404795.1.11487 WP_003404795.1.11489 WP_003404795.1.11491 WP_003404795.1.11514 WP_003404795.1.11587 WP_003404795.1.11589 WP_003404795.1.11596 WP_003404795.1.11604 WP_003404795.1.11610 WP_003404795.1.11697 WP_003404795.1.11707 WP_003404795.1.11752 WP_003404795.1.11758 WP_003404795.1.11761 WP_003404795.1.11775 WP_003404795.1.11804 WP_003404795.1.11822 WP_003404795.1.11826 WP_003404795.1.11856 WP_003404795.1.11898 WP_003404795.1.11906 WP_003404795.1.11939 WP_003404795.1.11960 WP_003404795.1.11961 WP_003404795.1.11972 WP_003404795.1.11984 WP_003404795.1.120 WP_003404795.1.12001 WP_003404795.1.12049 WP_003404795.1.12052 WP_003404795.1.12100 WP_003404795.1.12116 WP_003404795.1.12130 WP_003404795.1.12161 WP_003404795.1.12165 WP_003404795.1.12184 WP_003404795.1.12187 WP_003404795.1.12190 WP_003404795.1.12216 WP_003404795.1.12265 WP_003404795.1.12275 WP_003404795.1.12293 WP_003404795.1.12294 WP_003404795.1.123 WP_003404795.1.1231 WP_003404795.1.12314 WP_003404795.1.12327 WP_003404795.1.12338 WP_003404795.1.1236 WP_003404795.1.12371 WP_003404795.1.12372 WP_003404795.1.12389 WP_003404795.1.12406 WP_003404795.1.1241 WP_003404795.1.12421 WP_003404795.1.12424 WP_003404795.1.12446 WP_003404795.1.12464 WP_003404795.1.12479 WP_003404795.1.12519 WP_003404795.1.12523 WP_003404795.1.12526 WP_003404795.1.1255 WP_003404795.1.12550 WP_003404795.1.12551 WP_003404795.1.12563 WP_003404795.1.12611 WP_003404795.1.12669 WP_003404795.1.1267 WP_003404795.1.12672 WP_003404795.1.12692 WP_003404795.1.1271 WP_003404795.1.12710 WP_003404795.1.12768 WP_003404795.1.1279 WP_003404795.1.12794 WP_003404795.1.12801 WP_003404795.1.12804 WP_003404795.1.12821 WP_003404795.1.12841 WP_003404795.1.12854 WP_003404795.1.12871 WP_003404795.1.12901 WP_003404795.1.12941 WP_003404795.1.12947 WP_003404795.1.12957 WP_003404795.1.12972 WP_003404795.1.13028 WP_003404795.1.13043 WP_003404795.1.13087 WP_003404795.1.13090 WP_003404795.1.13096 WP_003404795.1.13163 WP_003404795.1.13175 WP_003404795.1.13183 WP_003404795.1.132 WP_003404795.1.13249 WP_003404795.1.13282 WP_003404795.1.13284 WP_003404795.1.13296 WP_003404795.1.13298 WP_003404795.1.13302 WP_003404795.1.13306 WP_003404795.1.13312 WP_003404795.1.13313 WP_003404795.1.13321 WP_003404795.1.13345 WP_003404795.1.13358 WP_003404795.1.13370 WP_003404795.1.13375 WP_003404795.1.1338 WP_003404795.1.13420 WP_003404795.1.13433 WP_003404795.1.13435 WP_003404795.1.13438 WP_003404795.1.13466 WP_003404795.1.13489 WP_003404795.1.13526 WP_003404795.1.13551 WP_003404795.1.13564 WP_003404795.1.13579 WP_003404795.1.13647 WP_003404795.1.13687 WP_003404795.1.13697 WP_003404795.1.13719 WP_003404795.1.13763 WP_003404795.1.1377 WP_003404795.1.13774 WP_003404795.1.13786 WP_003404795.1.13793 WP_003404795.1.13794 WP_003404795.1.13817 WP_003404795.1.13834 WP_003404795.1.13866 WP_003404795.1.13880 WP_003404795.1.13899 WP_003404795.1.13909 WP_003404795.1.13910 WP_003404795.1.13919 WP_003404795.1.13920 WP_003404795.1.13952 WP_003404795.1.13953 WP_003404795.1.13962 WP_003404795.1.1398 WP_003404795.1.13988 WP_003404795.1.14027 WP_003404795.1.14046 WP_003404795.1.14115 WP_003404795.1.1415 WP_003404795.1.14152 WP_003404795.1.14158 WP_003404795.1.14162 WP_003404795.1.14175 WP_003404795.1.14178 WP_003404795.1.14194 WP_003404795.1.14195 WP_003404795.1.14208 WP_003404795.1.14238 WP_003404795.1.14266 WP_003404795.1.14273 WP_003404795.1.14303 WP_003404795.1.14306 WP_003404795.1.14307 WP_003404795.1.14310 WP_003404795.1.14341 WP_003404795.1.14382 WP_003404795.1.14416 WP_003404795.1.14428 WP_003404795.1.14441 WP_003404795.1.14469 WP_003404795.1.14477 WP_003404795.1.14504 WP_003404795.1.14514 WP_003404795.1.1452 WP_003404795.1.14527 WP_003404795.1.1454 WP_003404795.1.14544 WP_003404795.1.14548 WP_003404795.1.14551 WP_003404795.1.14561 WP_003404795.1.14573 WP_003404795.1.1462 WP_003404795.1.14658 WP_003404795.1.14667 WP_003404795.1.14668 WP_003404795.1.14675 WP_003404795.1.14694 WP_003404795.1.14695 WP_003404795.1.14709 WP_003404795.1.14766 WP_003404795.1.14783 WP_003404795.1.14865 WP_003404795.1.14872 WP_003404795.1.14905 WP_003404795.1.14926 WP_003404795.1.14951 WP_003404795.1.14955 WP_003404795.1.15003 WP_003404795.1.15009 WP_003404795.1.15028 WP_003404795.1.15040 WP_003404795.1.15052 WP_003404795.1.15065 WP_003404795.1.15072 WP_003404795.1.15089 WP_003404795.1.1509 WP_003404795.1.15126 WP_003404795.1.15131 WP_003404795.1.15168 WP_003404795.1.15172 WP_003404795.1.15174 WP_003404795.1.15196 WP_003404795.1.15210 WP_003404795.1.15216 WP_003404795.1.15217 WP_003404795.1.1523 WP_003404795.1.15232 WP_003404795.1.15238 WP_003404795.1.15240 WP_003404795.1.15253 WP_003404795.1.15267 WP_003404795.1.1527 WP_003404795.1.15292 WP_003404795.1.15299 WP_003404795.1.15302 WP_003404795.1.15322 WP_003404795.1.1534 WP_003404795.1.15345 WP_003404795.1.15365 WP_003404795.1.15372 WP_003404795.1.15386 WP_003404795.1.15387 WP_003404795.1.15442 WP_003404795.1.15447 WP_003404795.1.15449 WP_003404795.1.15477 WP_003404795.1.15481 WP_003404795.1.15492 WP_003404795.1.15511 WP_003404795.1.15512 WP_003404795.1.15558 WP_003404795.1.15559 WP_003404795.1.15566 WP_003404795.1.15599 WP_003404795.1.1560 WP_003404795.1.15611 WP_003404795.1.1563 WP_003404795.1.15633 WP_003404795.1.15643 WP_003404795.1.15688 WP_003404795.1.15755 WP_003404795.1.15763 WP_003404795.1.15774 WP_003404795.1.1578 WP_003404795.1.15780 WP_003404795.1.15827 WP_003404795.1.15834 WP_003404795.1.15842 WP_003404795.1.15848 WP_003404795.1.15853 WP_003404795.1.15870 WP_003404795.1.15877 WP_003404795.1.15893 WP_003404795.1.15896 WP_003404795.1.15926 WP_003404795.1.15933 WP_003404795.1.15946 WP_003404795.1.15958 WP_003404795.1.15973 WP_003404795.1.15987 WP_003404795.1.15993 WP_003404795.1.16009 WP_003404795.1.16025 WP_003404795.1.16043 WP_003404795.1.16055 WP_003404795.1.16066 WP_003404795.1.16069 WP_003404795.1.16077 WP_003404795.1.16106 WP_003404795.1.16108 WP_003404795.1.16130 WP_003404795.1.16136 WP_003404795.1.16139 WP_003404795.1.16141 WP_003404795.1.16143 WP_003404795.1.1630 WP_003404795.1.16318 WP_003404795.1.1632 WP_003404795.1.16327 WP_003404795.1.16334 WP_003404795.1.16341 WP_003404795.1.16345 WP_003404795.1.16374 WP_003404795.1.16384 WP_003404795.1.16386 WP_003404795.1.164 WP_003404795.1.1642 WP_003404795.1.16421 WP_003404795.1.16424 WP_003404795.1.16426 WP_003404795.1.16431 WP_003404795.1.16438 WP_003404795.1.1644 WP_003404795.1.16442 WP_003404795.1.16448 WP_003404795.1.16451 WP_003404795.1.16476 WP_003404795.1.16480 WP_003404795.1.16494 WP_003404795.1.1652 WP_003404795.1.16549 WP_003404795.1.16560 WP_003404795.1.16598 WP_003404795.1.16609 WP_003404795.1.16619 WP_003404795.1.16620 WP_003404795.1.16622 WP_003404795.1.16637 WP_003404795.1.1669 WP_003404795.1.16707 WP_003404795.1.16724 WP_003404795.1.16731 WP_003404795.1.16743 WP_003404795.1.1683 WP_003404795.1.16837 WP_003404795.1.16852 WP_003404795.1.16937 WP_003404795.1.16940 WP_003404795.1.16950 WP_003404795.1.16959 WP_003404795.1.1697 WP_003404795.1.16973 WP_003404795.1.16977 WP_003404795.1.16987 WP_003404795.1.17005 WP_003404795.1.17006 WP_003404795.1.17010 WP_003404795.1.17015 WP_003404795.1.17019 WP_003404795.1.17039 WP_003404795.1.17041 WP_003404795.1.17052 WP_003404795.1.17057 WP_003404795.1.17062 WP_003404795.1.1707 WP_003404795.1.17094 WP_003404795.1.17130 WP_003404795.1.17138 WP_003404795.1.17147 WP_003404795.1.17167 WP_003404795.1.17224 WP_003404795.1.17251 WP_003404795.1.17288 WP_003404795.1.17304 WP_003404795.1.17314 WP_003404795.1.17381 WP_003404795.1.17391 WP_003404795.1.17412 WP_003404795.1.1743 WP_003404795.1.17440 WP_003404795.1.17466 WP_003404795.1.17477 WP_003404795.1.17483 WP_003404795.1.17505 WP_003404795.1.17527 WP_003404795.1.17535 WP_003404795.1.17540 WP_003404795.1.17553 WP_003404795.1.17558 WP_003404795.1.17599 WP_003404795.1.17635 WP_003404795.1.17655 WP_003404795.1.17679 WP_003404795.1.1768 WP_003404795.1.17687 WP_003404795.1.17700 WP_003404795.1.17710 WP_003404795.1.17713 WP_003404795.1.17722 WP_003404795.1.17746 WP_003404795.1.17788 WP_003404795.1.17798 WP_003404795.1.17803 WP_003404795.1.17821 WP_003404795.1.17830 WP_003404795.1.17868 WP_003404795.1.17878 WP_003404795.1.1792 WP_003404795.1.17923 WP_003404795.1.1795 WP_003404795.1.17955 WP_003404795.1.17973 WP_003404795.1.18009 WP_003404795.1.18013 WP_003404795.1.18033 WP_003404795.1.18057 WP_003404795.1.18065 WP_003404795.1.18070 WP_003404795.1.18116 WP_003404795.1.18120 WP_003404795.1.18126 WP_003404795.1.1817 WP_003404795.1.18170 WP_003404795.1.18206 WP_003404795.1.18216 WP_003404795.1.18240 WP_003404795.1.18257 WP_003404795.1.18297 WP_003404795.1.18306 WP_003404795.1.18364 WP_003404795.1.18399 WP_003404795.1.18411 WP_003404795.1.18444 WP_003404795.1.18448 WP_003404795.1.18467 WP_003404795.1.18476 WP_003404795.1.18522 WP_003404795.1.18580 WP_003404795.1.18582 WP_003404795.1.18587 WP_003404795.1.186 WP_003404795.1.18601 WP_003404795.1.18639 WP_003404795.1.18646 WP_003404795.1.18647 WP_003404795.1.1868 WP_003404795.1.18694 WP_003404795.1.18710 WP_003404795.1.18751 WP_003404795.1.18781 WP_003404795.1.18793 WP_003404795.1.18804 WP_003404795.1.18816 WP_003404795.1.18823 WP_003404795.1.18827 WP_003404795.1.18838 WP_003404795.1.18849 WP_003404795.1.18856 WP_003404795.1.18945 WP_003404795.1.1898 WP_003404795.1.19005 WP_003404795.1.19056 WP_003404795.1.19063 WP_003404795.1.19066 WP_003404795.1.19071 WP_003404795.1.19085 WP_003404795.1.19094 WP_003404795.1.19144 WP_003404795.1.19159 WP_003404795.1.19193 WP_003404795.1.19231 WP_003404795.1.19243 WP_003404795.1.19264 WP_003404795.1.19295 WP_003404795.1.19307 WP_003404795.1.19326 WP_003404795.1.1933 WP_003404795.1.19364 WP_003404795.1.19382 WP_003404795.1.19400 WP_003404795.1.19426 WP_003404795.1.19429 WP_003404795.1.19464 WP_003404795.1.19480 WP_003404795.1.19512 WP_003404795.1.19553 WP_003404795.1.19562 WP_003404795.1.19564 WP_003404795.1.19568 WP_003404795.1.19572 WP_003404795.1.19595 WP_003404795.1.19596 WP_003404795.1.19600 WP_003404795.1.19630 WP_003404795.1.1967 WP_003404795.1.19694 WP_003404795.1.1970 WP_003404795.1.19707 WP_003404795.1.19742 WP_003404795.1.19785 WP_003404795.1.19820 WP_003404795.1.19868 WP_003404795.1.19874 WP_003404795.1.19890 WP_003404795.1.19900 WP_003404795.1.19922 WP_003404795.1.19936 WP_003404795.1.19946 WP_003404795.1.19949 WP_003404795.1.19960 WP_003404795.1.19964 WP_003404795.1.20007 WP_003404795.1.20016 WP_003404795.1.20028 WP_003404795.1.2003 WP_003404795.1.20037 WP_003404795.1.20039 WP_003404795.1.20082 WP_003404795.1.20085 WP_003404795.1.20097 WP_003404795.1.20116 WP_003404795.1.20130 WP_003404795.1.20140 WP_003404795.1.20141 WP_003404795.1.20142 WP_003404795.1.20158 WP_003404795.1.20239 WP_003404795.1.20243 WP_003404795.1.20259 WP_003404795.1.20262 WP_003404795.1.20268 WP_003404795.1.20272 WP_003404795.1.20273 WP_003404795.1.20280 WP_003404795.1.20294 WP_003404795.1.20300 WP_003404795.1.20309 WP_003404795.1.20322 WP_003404795.1.2037 WP_003404795.1.20372 WP_003404795.1.20381 WP_003404795.1.204 WP_003404795.1.20427 WP_003404795.1.20432 WP_003404795.1.20457 WP_003404795.1.20459 WP_003404795.1.20460 WP_003404795.1.20542 WP_003404795.1.20578 WP_003404795.1.20608 WP_003404795.1.20624 WP_003404795.1.20628 WP_003404795.1.2066 WP_003404795.1.20707 WP_003404795.1.20722 WP_003404795.1.20729 WP_003404795.1.20742 WP_003404795.1.20751 WP_003404795.1.20776 WP_003404795.1.20843 WP_003404795.1.20850 WP_003404795.1.2086 WP_003404795.1.20868 WP_003404795.1.20876 WP_003404795.1.20897 WP_003404795.1.20898 WP_003404795.1.2090 WP_003404795.1.20911 WP_003404795.1.20916 WP_003404795.1.20921 WP_003404795.1.20926 WP_003404795.1.20927 WP_003404795.1.20951 WP_003404795.1.20970 WP_003404795.1.2104 WP_003404795.1.21070 WP_003404795.1.21127 WP_003404795.1.21135 WP_003404795.1.21173 WP_003404795.1.21187 WP_003404795.1.212 WP_003404795.1.2120 WP_003404795.1.21218 WP_003404795.1.21219 WP_003404795.1.2123 WP_003404795.1.21231 WP_003404795.1.21234 WP_003404795.1.2126 WP_003404795.1.21292 WP_003404795.1.21307 WP_003404795.1.2131 WP_003404795.1.21311 WP_003404795.1.21321 WP_003404795.1.21365 WP_003404795.1.2137 WP_003404795.1.21392 WP_003404795.1.21397 WP_003404795.1.21403 WP_003404795.1.21415 WP_003404795.1.21418 WP_003404795.1.21430 WP_003404795.1.21434 WP_003404795.1.21444 WP_003404795.1.21468 WP_003404795.1.21498 WP_003404795.1.21509 WP_003404795.1.21513 WP_003404795.1.21560 WP_003404795.1.21565 WP_003404795.1.21586 WP_003404795.1.21591 WP_003404795.1.21594 WP_003404795.1.21602 WP_003404795.1.21615 WP_003404795.1.21638 WP_003404795.1.21639 WP_003404795.1.21655 WP_003404795.1.21658 WP_003404795.1.2168 WP_003404795.1.2174 WP_003404795.1.21741 WP_003404795.1.21742 WP_003404795.1.21777 WP_003404795.1.21786 WP_003404795.1.21795 WP_003404795.1.218 WP_003404795.1.21826 WP_003404795.1.21829 WP_003404795.1.21840 WP_003404795.1.21843 WP_003404795.1.21872 WP_003404795.1.21873 WP_003404795.1.2188 WP_003404795.1.21882 WP_003404795.1.21906 WP_003404795.1.21912 WP_003404795.1.2194 WP_003404795.1.21941 WP_003404795.1.21956 WP_003404795.1.21958 WP_003404795.1.21960 WP_003404795.1.21971 WP_003404795.1.21973 WP_003404795.1.21983 WP_003404795.1.22003 WP_003404795.1.22013 WP_003404795.1.22025 WP_003404795.1.22036 WP_003404795.1.22075 WP_003404795.1.22092 WP_003404795.1.2212 WP_003404795.1.22127 WP_003404795.1.22140 WP_003404795.1.22233 WP_003404795.1.22255 WP_003404795.1.22277 WP_003404795.1.22305 WP_003404795.1.22348 WP_003404795.1.22356 WP_003404795.1.22366 WP_003404795.1.2238 WP_003404795.1.22380 WP_003404795.1.22437 WP_003404795.1.22438 WP_003404795.1.22445 WP_003404795.1.22490 WP_003404795.1.22511 WP_003404795.1.22524 WP_003404795.1.2253 WP_003404795.1.22585 WP_003404795.1.22589 WP_003404795.1.22606 WP_003404795.1.22608 WP_003404795.1.22609 WP_003404795.1.22618 WP_003404795.1.2262 WP_003404795.1.22624 WP_003404795.1.22629 WP_003404795.1.22647 WP_003404795.1.22664 WP_003404795.1.22665 WP_003404795.1.22670 WP_003404795.1.22674 WP_003404795.1.22680 WP_003404795.1.22725 WP_003404795.1.22728 WP_003404795.1.22733 WP_003404795.1.22737 WP_003404795.1.2275 WP_003404795.1.22754 WP_003404795.1.22797 WP_003404795.1.22800 WP_003404795.1.22804 WP_003404795.1.22829 WP_003404795.1.22840 WP_003404795.1.22844 WP_003404795.1.22963 WP_003404795.1.22970 WP_003404795.1.22996 WP_003404795.1.22997 WP_003404795.1.22999 WP_003404795.1.23015 WP_003404795.1.23032 WP_003404795.1.231 WP_003404795.1.23101 WP_003404795.1.2312 WP_003404795.1.23140 WP_003404795.1.23153 WP_003404795.1.23171 WP_003404795.1.23199 WP_003404795.1.2320 WP_003404795.1.23204 WP_003404795.1.23216 WP_003404795.1.23229 WP_003404795.1.23233 WP_003404795.1.2326 WP_003404795.1.23261 WP_003404795.1.23272 WP_003404795.1.23289 WP_003404795.1.2329 WP_003404795.1.23308 WP_003404795.1.23316 WP_003404795.1.23321 WP_003404795.1.23325 WP_003404795.1.2339 WP_003404795.1.23406 WP_003404795.1.23438 WP_003404795.1.23445 WP_003404795.1.23447 WP_003404795.1.23452 WP_003404795.1.2349 WP_003404795.1.23496 WP_003404795.1.23497 WP_003404795.1.23506 WP_003404795.1.23530 WP_003404795.1.23539 WP_003404795.1.23546 WP_003404795.1.23551 WP_003404795.1.23573 WP_003404795.1.23583 WP_003404795.1.23588 WP_003404795.1.23628 WP_003404795.1.23677 WP_003404795.1.23683 WP_003404795.1.23692 WP_003404795.1.23694 WP_003404795.1.23699 WP_003404795.1.2371 WP_003404795.1.23803 WP_003404795.1.23807 WP_003404795.1.23825 WP_003404795.1.23832 WP_003404795.1.2384 WP_003404795.1.23843 WP_003404795.1.23863 WP_003404795.1.2387 WP_003404795.1.23894 WP_003404795.1.23993 WP_003404795.1.2400 WP_003404795.1.24007 WP_003404795.1.24008 WP_003404795.1.24046 WP_003404795.1.24057 WP_003404795.1.24062 WP_003404795.1.24113 WP_003404795.1.24119 WP_003404795.1.24128 WP_003404795.1.24140 WP_003404795.1.24176 WP_003404795.1.24190 WP_003404795.1.24202 WP_003404795.1.24244 WP_003404795.1.24261 WP_003404795.1.24284 WP_003404795.1.24294 WP_003404795.1.24357 WP_003404795.1.24396 WP_003404795.1.24414 WP_003404795.1.24423 WP_003404795.1.2443 WP_003404795.1.24446 WP_003404795.1.24461 WP_003404795.1.24500 WP_003404795.1.24507 WP_003404795.1.24509 WP_003404795.1.24529 WP_003404795.1.24553 WP_003404795.1.24599 WP_003404795.1.24629 WP_003404795.1.24638 WP_003404795.1.24648 WP_003404795.1.2466 WP_003404795.1.24767 WP_003404795.1.24824 WP_003404795.1.24831 WP_003404795.1.24840 WP_003404795.1.24848 WP_003404795.1.24857 WP_003404795.1.2487 WP_003404795.1.24893 WP_003404795.1.24907 WP_003404795.1.24933 WP_003404795.1.24956 WP_003404795.1.24958 WP_003404795.1.24985 WP_003404795.1.2499 WP_003404795.1.25004 WP_003404795.1.2505 WP_003404795.1.25051 WP_003404795.1.2507 WP_003404795.1.25096 WP_003404795.1.25103 WP_003404795.1.25129 WP_003404795.1.25171 WP_003404795.1.25184 WP_003404795.1.25247 WP_003404795.1.25252 WP_003404795.1.25278 WP_003404795.1.25283 WP_003404795.1.25309 WP_003404795.1.25313 WP_003404795.1.25338 WP_003404795.1.25342 WP_003404795.1.25343 WP_003404795.1.25367 WP_003404795.1.25393 WP_003404795.1.25406 WP_003404795.1.25435 WP_003404795.1.25437 WP_003404795.1.25445 WP_003404795.1.25455 WP_003404795.1.25473 WP_003404795.1.25504 WP_003404795.1.25513 WP_003404795.1.25542 WP_003404795.1.25579 WP_003404795.1.25594 WP_003404795.1.25606 WP_003404795.1.25645 WP_003404795.1.2566 WP_003404795.1.25673 WP_003404795.1.25674 WP_003404795.1.25693 WP_003404795.1.25699 WP_003404795.1.25727 WP_003404795.1.25736 WP_003404795.1.25738 WP_003404795.1.25756 WP_003404795.1.25759 WP_003404795.1.2580 WP_003404795.1.25813 WP_003404795.1.25853 WP_003404795.1.25854 WP_003404795.1.25874 WP_003404795.1.25885 WP_003404795.1.25892 WP_003404795.1.25906 WP_003404795.1.25914 WP_003404795.1.25916 WP_003404795.1.2594 WP_003404795.1.25954 WP_003404795.1.25965 WP_003404795.1.25972 WP_003404795.1.26017 WP_003404795.1.26032 WP_003404795.1.26038 WP_003404795.1.26072 WP_003404795.1.26089 WP_003404795.1.26097 WP_003404795.1.26098 WP_003404795.1.26108 WP_003404795.1.26118 WP_003404795.1.26126 WP_003404795.1.2614 WP_003404795.1.26168 WP_003404795.1.26182 WP_003404795.1.26190 WP_003404795.1.2620 WP_003404795.1.26234 WP_003404795.1.26243 WP_003404795.1.26265 WP_003404795.1.26267 WP_003404795.1.26292 WP_003404795.1.26310 WP_003404795.1.26328 WP_003404795.1.26349 WP_003404795.1.26366 WP_003404795.1.26374 WP_003404795.1.26407 WP_003404795.1.26412 WP_003404795.1.26454 WP_003404795.1.26464 WP_003404795.1.2653 WP_003404795.1.26560 WP_003404795.1.26571 WP_003404795.1.2659 WP_003404795.1.26597 WP_003404795.1.26603 WP_003404795.1.26629 WP_003404795.1.26651 WP_003404795.1.26702 WP_003404795.1.26707 WP_003404795.1.26710 WP_003404795.1.26719 WP_003404795.1.26737 WP_003404795.1.26738 WP_003404795.1.26745 WP_003404795.1.26756 WP_003404795.1.2676 WP_003404795.1.2677 WP_003404795.1.26779 WP_003404795.1.26780 WP_003404795.1.26798 WP_003404795.1.26854 WP_003404795.1.26868 WP_003404795.1.26876 WP_003404795.1.26888 WP_003404795.1.26914 WP_003404795.1.26945 WP_003404795.1.26959 WP_003404795.1.26969 WP_003404795.1.26984 WP_003404795.1.26992 WP_003404795.1.27004 WP_003404795.1.27017 WP_003404795.1.27045 WP_003404795.1.27074 WP_003404795.1.27075 WP_003404795.1.27128 WP_003404795.1.27130 WP_003404795.1.27139 WP_003404795.1.27152 WP_003404795.1.27162 WP_003404795.1.27164 WP_003404795.1.27193 WP_003404795.1.27235 WP_003404795.1.27254 WP_003404795.1.27278 WP_003404795.1.27343 WP_003404795.1.27352 WP_003404795.1.27369 WP_003404795.1.27391 WP_003404795.1.27398 WP_003404795.1.27402 WP_003404795.1.27410 WP_003404795.1.27411 WP_003404795.1.27449 WP_003404795.1.27460 WP_003404795.1.27463 WP_003404795.1.2749 WP_003404795.1.27492 WP_003404795.1.27528 WP_003404795.1.27541 WP_003404795.1.27576 WP_003404795.1.27582 WP_003404795.1.27596 WP_003404795.1.27607 WP_003404795.1.2766 WP_003404795.1.277 WP_003404795.1.27724 WP_003404795.1.27730 WP_003404795.1.27736 WP_003404795.1.27743 WP_003404795.1.27750 WP_003404795.1.27771 WP_003404795.1.27779 WP_003404795.1.27795 WP_003404795.1.27803 WP_003404795.1.27819 WP_003404795.1.27835 WP_003404795.1.27915 WP_003404795.1.27935 WP_003404795.1.27962 WP_003404795.1.28053 WP_003404795.1.28092 WP_003404795.1.28131 WP_003404795.1.28142 WP_003404795.1.28159 WP_003404795.1.2816 WP_003404795.1.28161 WP_003404795.1.28192 WP_003404795.1.28202 WP_003404795.1.28241 WP_003404795.1.28242 WP_003404795.1.28251 WP_003404795.1.28255 WP_003404795.1.28269 WP_003404795.1.28276 WP_003404795.1.28293 WP_003404795.1.28331 WP_003404795.1.28367 WP_003404795.1.28378 WP_003404795.1.28391 WP_003404795.1.2842 WP_003404795.1.28448 WP_003404795.1.2847 WP_003404795.1.28471 WP_003404795.1.28473 WP_003404795.1.28493 WP_003404795.1.28497 WP_003404795.1.28530 WP_003404795.1.28545 WP_003404795.1.28561 WP_003404795.1.28567 WP_003404795.1.28585 WP_003404795.1.286 WP_003404795.1.28610 WP_003404795.1.28617 WP_003404795.1.28634 WP_003404795.1.28642 WP_003404795.1.28671 WP_003404795.1.28682 WP_003404795.1.28698 WP_003404795.1.28703 WP_003404795.1.28739 WP_003404795.1.28758 WP_003404795.1.28781 WP_003404795.1.28787 WP_003404795.1.28827 WP_003404795.1.28839 WP_003404795.1.28847 WP_003404795.1.28850 WP_003404795.1.28851 WP_003404795.1.28865 WP_003404795.1.28897 WP_003404795.1.28914 WP_003404795.1.28935 WP_003404795.1.28936 WP_003404795.1.28939 WP_003404795.1.28943 WP_003404795.1.28952 WP_003404795.1.28975 WP_003404795.1.2899 WP_003404795.1.28993 WP_003404795.1.29000 WP_003404795.1.2901 WP_003404795.1.29028 WP_003404795.1.29033 WP_003404795.1.29058 WP_003404795.1.29078 WP_003404795.1.29102 WP_003404795.1.29115 WP_003404795.1.2916 WP_003404795.1.29217 WP_003404795.1.29223 WP_003404795.1.29234 WP_003404795.1.29264 WP_003404795.1.29275 WP_003404795.1.29306 WP_003404795.1.29339 WP_003404795.1.29348 WP_003404795.1.29364 WP_003404795.1.29367 WP_003404795.1.2938 WP_003404795.1.29399 WP_003404795.1.29426 WP_003404795.1.2944 WP_003404795.1.29449 WP_003404795.1.29450 WP_003404795.1.29452 WP_003404795.1.2949 WP_003404795.1.29510 WP_003404795.1.29515 WP_003404795.1.29525 WP_003404795.1.2953 WP_003404795.1.29559 WP_003404795.1.29587 WP_003404795.1.2959 WP_003404795.1.29592 WP_003404795.1.29599 WP_003404795.1.29611 WP_003404795.1.29632 WP_003404795.1.29649 WP_003404795.1.2965 WP_003404795.1.29659 WP_003404795.1.2969 WP_003404795.1.29696 WP_003404795.1.29698 WP_003404795.1.29718 WP_003404795.1.29742 WP_003404795.1.29745 WP_003404795.1.29747 WP_003404795.1.29769 WP_003404795.1.29825 WP_003404795.1.29830 WP_003404795.1.29847 WP_003404795.1.29861 WP_003404795.1.29869 WP_003404795.1.29883 WP_003404795.1.29890 WP_003404795.1.299 WP_003404795.1.29931 WP_003404795.1.29960 WP_003404795.1.30014 WP_003404795.1.3004 WP_003404795.1.30040 WP_003404795.1.30043 WP_003404795.1.30074 WP_003404795.1.30097 WP_003404795.1.30101 WP_003404795.1.30106 WP_003404795.1.30114 WP_003404795.1.30126 WP_003404795.1.30131 WP_003404795.1.30138 WP_003404795.1.30139 WP_003404795.1.30145 WP_003404795.1.30211 WP_003404795.1.30224 WP_003404795.1.30235 WP_003404795.1.30237 WP_003404795.1.3027 WP_003404795.1.30279 WP_003404795.1.30282 WP_003404795.1.30283 WP_003404795.1.30288 WP_003404795.1.30291 WP_003404795.1.30363 WP_003404795.1.30374 WP_003404795.1.30404 WP_003404795.1.3043 WP_003404795.1.30433 WP_003404795.1.30438 WP_003404795.1.30462 WP_003404795.1.30464 WP_003404795.1.30468 WP_003404795.1.30500 WP_003404795.1.3057 WP_003404795.1.30574 WP_003404795.1.30628 WP_003404795.1.30641 WP_003404795.1.30642 WP_003404795.1.30661 WP_003404795.1.30669 WP_003404795.1.30683 WP_003404795.1.30699 WP_003404795.1.30709 WP_003404795.1.30713 WP_003404795.1.30716 WP_003404795.1.30719 WP_003404795.1.30730 WP_003404795.1.30732 WP_003404795.1.30736 WP_003404795.1.30745 WP_003404795.1.30760 WP_003404795.1.30791 WP_003404795.1.308 WP_003404795.1.30807 WP_003404795.1.30818 WP_003404795.1.30824 WP_003404795.1.30848 WP_003404795.1.30877 WP_003404795.1.30888 WP_003404795.1.30901 WP_003404795.1.30903 WP_003404795.1.30912 WP_003404795.1.30913 WP_003404795.1.30914 WP_003404795.1.30919 WP_003404795.1.30977 WP_003404795.1.3100 WP_003404795.1.31002 WP_003404795.1.3101 WP_003404795.1.31034 WP_003404795.1.31047 WP_003404795.1.31070 WP_003404795.1.31074 WP_003404795.1.31102 WP_003404795.1.31127 WP_003404795.1.31184 WP_003404795.1.31199 WP_003404795.1.31226 WP_003404795.1.31230 WP_003404795.1.31233 WP_003404795.1.31263 WP_003404795.1.31264 WP_003404795.1.31270 WP_003404795.1.31287 WP_003404795.1.31290 WP_003404795.1.31346 WP_003404795.1.31348 WP_003404795.1.31354 WP_003404795.1.31390 WP_003404795.1.31414 WP_003404795.1.31417 WP_003404795.1.31428 WP_003404795.1.3143 WP_003404795.1.31458 WP_003404795.1.31483 WP_003404795.1.3149 WP_003404795.1.31498 WP_003404795.1.31507 WP_003404795.1.31537 WP_003404795.1.31548 WP_003404795.1.31569 WP_003404795.1.31573 WP_003404795.1.316 WP_003404795.1.31629 WP_003404795.1.31666 WP_003404795.1.31693 WP_003404795.1.31703 WP_003404795.1.31744 WP_003404795.1.31745 WP_003404795.1.31770 WP_003404795.1.31776 WP_003404795.1.31783 WP_003404795.1.318 WP_003404795.1.3184 WP_003404795.1.31840 WP_003404795.1.31880 WP_003404795.1.31911 WP_003404795.1.31930 WP_003404795.1.31932 WP_003404795.1.31955 WP_003404795.1.31985 WP_003404795.1.31991 WP_003404795.1.31995 WP_003404795.1.32004 WP_003404795.1.32039 WP_003404795.1.3204 WP_003404795.1.32045 WP_003404795.1.32071 WP_003404795.1.32098 WP_003404795.1.32132 WP_003404795.1.32157 WP_003404795.1.32164 WP_003404795.1.32179 WP_003404795.1.32198 WP_003404795.1.32297 WP_003404795.1.32383 WP_003404795.1.32400 WP_003404795.1.32403 WP_003404795.1.32416 WP_003404795.1.32421 WP_003404795.1.32433 WP_003404795.1.32461 WP_003404795.1.32482 WP_003404795.1.32503 WP_003404795.1.32556 WP_003404795.1.32562 WP_003404795.1.32569 WP_003404795.1.32592 WP_003404795.1.32620 WP_003404795.1.32647 WP_003404795.1.32653 WP_003404795.1.32654 WP_003404795.1.3268 WP_003404795.1.32695 WP_003404795.1.32706 WP_003404795.1.32716 WP_003404795.1.32738 WP_003404795.1.32752 WP_003404795.1.32780 WP_003404795.1.32781 WP_003404795.1.32793 WP_003404795.1.32799 WP_003404795.1.32822 WP_003404795.1.32833 WP_003404795.1.32862 WP_003404795.1.32880 WP_003404795.1.32897 WP_003404795.1.32909 WP_003404795.1.32935 WP_003404795.1.32974 WP_003404795.1.33007 WP_003404795.1.3302 WP_003404795.1.33028 WP_003404795.1.33035 WP_003404795.1.33044 WP_003404795.1.33054 WP_003404795.1.33082 WP_003404795.1.33141 WP_003404795.1.33148 WP_003404795.1.33155 WP_003404795.1.33168 WP_003404795.1.3321 WP_003404795.1.33215 WP_003404795.1.3325 WP_003404795.1.3327 WP_003404795.1.33278 WP_003404795.1.33288 WP_003404795.1.33305 WP_003404795.1.3331 WP_003404795.1.33319 WP_003404795.1.3333 WP_003404795.1.33393 WP_003404795.1.33403 WP_003404795.1.33452 WP_003404795.1.33467 WP_003404795.1.33477 WP_003404795.1.3349 WP_003404795.1.33519 WP_003404795.1.33542 WP_003404795.1.33601 WP_003404795.1.33602 WP_003404795.1.33633 WP_003404795.1.33646 WP_003404795.1.33673 WP_003404795.1.3369 WP_003404795.1.33705 WP_003404795.1.33762 WP_003404795.1.33783 WP_003404795.1.33789 WP_003404795.1.3383 WP_003404795.1.33832 WP_003404795.1.33839 WP_003404795.1.33848 WP_003404795.1.3387 WP_003404795.1.33886 WP_003404795.1.33895 WP_003404795.1.33906 WP_003404795.1.33912 WP_003404795.1.33954 WP_003404795.1.3399 WP_003404795.1.34042 WP_003404795.1.3405 WP_003404795.1.34055 WP_003404795.1.34056 WP_003404795.1.34065 WP_003404795.1.3408 WP_003404795.1.34090 WP_003404795.1.34109 WP_003404795.1.34111 WP_003404795.1.34131 WP_003404795.1.34152 WP_003404795.1.34153 WP_003404795.1.34163 WP_003404795.1.34181 WP_003404795.1.34197 WP_003404795.1.34198 WP_003404795.1.34215 WP_003404795.1.34219 WP_003404795.1.34255 WP_003404795.1.34260 WP_003404795.1.34275 WP_003404795.1.343 WP_003404795.1.34347 WP_003404795.1.34358 WP_003404795.1.34392 WP_003404795.1.344 WP_003404795.1.34428 WP_003404795.1.3443 WP_003404795.1.34435 WP_003404795.1.34446 WP_003404795.1.34499 WP_003404795.1.34505 WP_003404795.1.34516 WP_003404795.1.34529 WP_003404795.1.34551 WP_003404795.1.34563 WP_003404795.1.34576 WP_003404795.1.34581 WP_003404795.1.34588 WP_003404795.1.34596 WP_003404795.1.34599 WP_003404795.1.34639 WP_003404795.1.34724 WP_003404795.1.34740 WP_003404795.1.34755 WP_003404795.1.34777 WP_003404795.1.34783 WP_003404795.1.34841 WP_003404795.1.34908 WP_003404795.1.34919 WP_003404795.1.3492 WP_003404795.1.34933 WP_003404795.1.34945 WP_003404795.1.34946 WP_003404795.1.34954 WP_003404795.1.34960 WP_003404795.1.34961 WP_003404795.1.34963 WP_003404795.1.34965 WP_003404795.1.34968 WP_003404795.1.35023 WP_003404795.1.35069 WP_003404795.1.35072 WP_003404795.1.35078 WP_003404795.1.35100 WP_003404795.1.35146 WP_003404795.1.35156 WP_003404795.1.35160 WP_003404795.1.35162 WP_003404795.1.35173 WP_003404795.1.35176 WP_003404795.1.3520 WP_003404795.1.35213 WP_003404795.1.35221 WP_003404795.1.35246 WP_003404795.1.35278 WP_003404795.1.35301 WP_003404795.1.35311 WP_003404795.1.35312 WP_003404795.1.35317 WP_003404795.1.35319 WP_003404795.1.35347 WP_003404795.1.35363 WP_003404795.1.35382 WP_003404795.1.35385 WP_003404795.1.35397 WP_003404795.1.35426 WP_003404795.1.35439 WP_003404795.1.35455 WP_003404795.1.3548 WP_003404795.1.35484 WP_003404795.1.35492 WP_003404795.1.3553 WP_003404795.1.35553 WP_003404795.1.35555 WP_003404795.1.35561 WP_003404795.1.35602 WP_003404795.1.35610 WP_003404795.1.35635 WP_003404795.1.35657 WP_003404795.1.35680 WP_003404795.1.35687 WP_003404795.1.35689 WP_003404795.1.35707 WP_003404795.1.35732 WP_003404795.1.35754 WP_003404795.1.35767 WP_003404795.1.35770 WP_003404795.1.35771 WP_003404795.1.35780 WP_003404795.1.35805 WP_003404795.1.35811 WP_003404795.1.35821 WP_003404795.1.3584 WP_003404795.1.35848 WP_003404795.1.35864 WP_003404795.1.35874 WP_003404795.1.35876 WP_003404795.1.35897 WP_003404795.1.35899 WP_003404795.1.35923 WP_003404795.1.3593 WP_003404795.1.35954 WP_003404795.1.36005 WP_003404795.1.36014 WP_003404795.1.36023 WP_003404795.1.36051 WP_003404795.1.36053 WP_003404795.1.36075 WP_003404795.1.36089 WP_003404795.1.36097 WP_003404795.1.36098 WP_003404795.1.36116 WP_003404795.1.36145 WP_003404795.1.36156 WP_003404795.1.36205 WP_003404795.1.36228 WP_003404795.1.36246 WP_003404795.1.36252 WP_003404795.1.36260 WP_003404795.1.36270 WP_003404795.1.36271 WP_003404795.1.36303 WP_003404795.1.36309 WP_003404795.1.36315 WP_003404795.1.36319 WP_003404795.1.36321 WP_003404795.1.36326 WP_003404795.1.3634 WP_003404795.1.36356 WP_003404795.1.36357 WP_003404795.1.3636 WP_003404795.1.36385 WP_003404795.1.36399 WP_003404795.1.36436 WP_003404795.1.36465 WP_003404795.1.36469 WP_003404795.1.36473 WP_003404795.1.36485 WP_003404795.1.36508 WP_003404795.1.36540 WP_003404795.1.36561 WP_003404795.1.36571 WP_003404795.1.36573 WP_003404795.1.36578 WP_003404795.1.36585 WP_003404795.1.36597 WP_003404795.1.36614 WP_003404795.1.36657 WP_003404795.1.36674 WP_003404795.1.36720 WP_003404795.1.36727 WP_003404795.1.36733 WP_003404795.1.36785 WP_003404795.1.36810 WP_003404795.1.36844 WP_003404795.1.36851 WP_003404795.1.36862 WP_003404795.1.36893 WP_003404795.1.36901 WP_003404795.1.36921 WP_003404795.1.36935 WP_003404795.1.36941 WP_003404795.1.3695 WP_003404795.1.36951 WP_003404795.1.36968 WP_003404795.1.3700 WP_003404795.1.37004 WP_003404795.1.37012 WP_003404795.1.37071 WP_003404795.1.37088 WP_003404795.1.37131 WP_003404795.1.37157 WP_003404795.1.37175 WP_003404795.1.37188 WP_003404795.1.37213 WP_003404795.1.37229 WP_003404795.1.3724 WP_003404795.1.37277 WP_003404795.1.37305 WP_003404795.1.37330 WP_003404795.1.37389 WP_003404795.1.37400 WP_003404795.1.37440 WP_003404795.1.37459 WP_003404795.1.37468 WP_003404795.1.37475 WP_003404795.1.37484 WP_003404795.1.37601 WP_003404795.1.37612 WP_003404795.1.37632 WP_003404795.1.37643 WP_003404795.1.37655 WP_003404795.1.37660 WP_003404795.1.37674 WP_003404795.1.37700 WP_003404795.1.37701 WP_003404795.1.37709 WP_003404795.1.37711 WP_003404795.1.37721 WP_003404795.1.37722 WP_003404795.1.37747 WP_003404795.1.37765 WP_003404795.1.37772 WP_003404795.1.37804 WP_003404795.1.37809 WP_003404795.1.37859 WP_003404795.1.37877 WP_003404795.1.37912 WP_003404795.1.37913 WP_003404795.1.37943 WP_003404795.1.37950 WP_003404795.1.37973 WP_003404795.1.37975 WP_003404795.1.37983 WP_003404795.1.38 WP_003404795.1.38002 WP_003404795.1.3802 WP_003404795.1.38039 WP_003404795.1.38040 WP_003404795.1.38067 WP_003404795.1.38068 WP_003404795.1.38135 WP_003404795.1.38138 WP_003404795.1.38144 WP_003404795.1.38158 WP_003404795.1.38159 WP_003404795.1.38210 WP_003404795.1.38233 WP_003404795.1.38240 WP_003404795.1.38299 WP_003404795.1.38332 WP_003404795.1.38347 WP_003404795.1.38354 WP_003404795.1.38380 WP_003404795.1.38384 WP_003404795.1.38389 WP_003404795.1.38398 WP_003404795.1.38402 WP_003404795.1.38418 WP_003404795.1.38421 WP_003404795.1.38466 WP_003404795.1.38477 WP_003404795.1.38483 WP_003404795.1.3849 WP_003404795.1.385 WP_003404795.1.38530 WP_003404795.1.38535 WP_003404795.1.38539 WP_003404795.1.38594 WP_003404795.1.38601 WP_003404795.1.38611 WP_003404795.1.38638 WP_003404795.1.38639 WP_003404795.1.38646 WP_003404795.1.38648 WP_003404795.1.38654 WP_003404795.1.38659 WP_003404795.1.38660 WP_003404795.1.38666 WP_003404795.1.38671 WP_003404795.1.38672 WP_003404795.1.38677 WP_003404795.1.38750 WP_003404795.1.38772 WP_003404795.1.38812 WP_003404795.1.38821 WP_003404795.1.38844 WP_003404795.1.38865 WP_003404795.1.38873 WP_003404795.1.3889 WP_003404795.1.38894 WP_003404795.1.38909 WP_003404795.1.38939 WP_003404795.1.38974 WP_003404795.1.38975 WP_003404795.1.38991 WP_003404795.1.39025 WP_003404795.1.39070 WP_003404795.1.39072 WP_003404795.1.39095 WP_003404795.1.39106 WP_003404795.1.39165 WP_003404795.1.39174 WP_003404795.1.39176 WP_003404795.1.39178 WP_003404795.1.39190 WP_003404795.1.39201 WP_003404795.1.39207 WP_003404795.1.39211 WP_003404795.1.39236 WP_003404795.1.39239 WP_003404795.1.39252 WP_003404795.1.39288 WP_003404795.1.39295 WP_003404795.1.39306 WP_003404795.1.39359 WP_003404795.1.39364 WP_003404795.1.39400 WP_003404795.1.39447 WP_003404795.1.3945 WP_003404795.1.39450 WP_003404795.1.39455 WP_003404795.1.3949 WP_003404795.1.39521 WP_003404795.1.39560 WP_003404795.1.39592 WP_003404795.1.39593 WP_003404795.1.396 WP_003404795.1.3960 WP_003404795.1.39616 WP_003404795.1.39654 WP_003404795.1.39657 WP_003404795.1.39661 WP_003404795.1.39674 WP_003404795.1.39678 WP_003404795.1.3968 WP_003404795.1.39694 WP_003404795.1.3971 WP_003404795.1.39718 WP_003404795.1.39728 WP_003404795.1.39739 WP_003404795.1.39748 WP_003404795.1.39751 WP_003404795.1.39759 WP_003404795.1.39801 WP_003404795.1.39804 WP_003404795.1.39848 WP_003404795.1.39877 WP_003404795.1.39925 WP_003404795.1.3994 WP_003404795.1.39959 WP_003404795.1.3996 WP_003404795.1.39960 WP_003404795.1.3997 WP_003404795.1.39980 WP_003404795.1.40000 WP_003404795.1.40028 WP_003404795.1.40029 WP_003404795.1.4003 WP_003404795.1.40094 WP_003404795.1.40096 WP_003404795.1.40150 WP_003404795.1.40156 WP_003404795.1.40174 WP_003404795.1.40186 WP_003404795.1.40276 WP_003404795.1.40277 WP_003404795.1.40323 WP_003404795.1.40336 WP_003404795.1.40353 WP_003404795.1.4036 WP_003404795.1.40372 WP_003404795.1.40402 WP_003404795.1.40413 WP_003404795.1.40440 WP_003404795.1.40446 WP_003404795.1.40451 WP_003404795.1.40455 WP_003404795.1.40523 WP_003404795.1.40543 WP_003404795.1.40641 WP_003404795.1.40646 WP_003404795.1.40651 WP_003404795.1.40653 WP_003404795.1.4067 WP_003404795.1.40705 WP_003404795.1.40723 WP_003404795.1.40731 WP_003404795.1.40735 WP_003404795.1.40799 WP_003404795.1.40852 WP_003404795.1.40876 WP_003404795.1.40881 WP_003404795.1.40922 WP_003404795.1.40948 WP_003404795.1.4095 WP_003404795.1.40956 WP_003404795.1.40957 WP_003404795.1.40964 WP_003404795.1.4097 WP_003404795.1.410 WP_003404795.1.41000 WP_003404795.1.41055 WP_003404795.1.41108 WP_003404795.1.41123 WP_003404795.1.41177 WP_003404795.1.41202 WP_003404795.1.41219 WP_003404795.1.41231 WP_003404795.1.41249 WP_003404795.1.4127 WP_003404795.1.41296 WP_003404795.1.41355 WP_003404795.1.41430 WP_003404795.1.41447 WP_003404795.1.41469 WP_003404795.1.41504 WP_003404795.1.41553 WP_003404795.1.41564 WP_003404795.1.41583 WP_003404795.1.41616 WP_003404795.1.41632 WP_003404795.1.41635 WP_003404795.1.41636 WP_003404795.1.41648 WP_003404795.1.41660 WP_003404795.1.41685 WP_003404795.1.41695 WP_003404795.1.41704 WP_003404795.1.41719 WP_003404795.1.41733 WP_003404795.1.41744 WP_003404795.1.41774 WP_003404795.1.41791 WP_003404795.1.41803 WP_003404795.1.41820 WP_003404795.1.41828 WP_003404795.1.41829 WP_003404795.1.41860 WP_003404795.1.41912 WP_003404795.1.41921 WP_003404795.1.41933 WP_003404795.1.41944 WP_003404795.1.42043 WP_003404795.1.42075 WP_003404795.1.42078 WP_003404795.1.42094 WP_003404795.1.42112 WP_003404795.1.4212 WP_003404795.1.42122 WP_003404795.1.42134 WP_003404795.1.42183 WP_003404795.1.42188 WP_003404795.1.42201 WP_003404795.1.42202 WP_003404795.1.42208 WP_003404795.1.42247 WP_003404795.1.42255 WP_003404795.1.42273 WP_003404795.1.42278 WP_003404795.1.42304 WP_003404795.1.42309 WP_003404795.1.42370 WP_003404795.1.42385 WP_003404795.1.42400 WP_003404795.1.42409 WP_003404795.1.42414 WP_003404795.1.42417 WP_003404795.1.42430 WP_003404795.1.42461 WP_003404795.1.42465 WP_003404795.1.42467 WP_003404795.1.42473 WP_003404795.1.42474 WP_003404795.1.4248 WP_003404795.1.42494 WP_003404795.1.42519 WP_003404795.1.42524 WP_003404795.1.42534 WP_003404795.1.4255 WP_003404795.1.42562 WP_003404795.1.42568 WP_003404795.1.42570 WP_003404795.1.42618 WP_003404795.1.42660 WP_003404795.1.42695 WP_003404795.1.42704 WP_003404795.1.42705 WP_003404795.1.42722 WP_003404795.1.42777 WP_003404795.1.42782 WP_003404795.1.42835 WP_003404795.1.42839 WP_003404795.1.42842 WP_003404795.1.42905 WP_003404795.1.42916 WP_003404795.1.42930 WP_003404795.1.42971 WP_003404795.1.43005 WP_003404795.1.43009 WP_003404795.1.43053 WP_003404795.1.43082 WP_003404795.1.43087 WP_003404795.1.43098 WP_003404795.1.43208 WP_003404795.1.43236 WP_003404795.1.43246 WP_003404795.1.43255 WP_003404795.1.43266 WP_003404795.1.43269 WP_003404795.1.43273 WP_003404795.1.43296 WP_003404795.1.43306 WP_003404795.1.4335 WP_003404795.1.43368 WP_003404795.1.43395 WP_003404795.1.43457 WP_003404795.1.43462 WP_003404795.1.43475 WP_003404795.1.43478 WP_003404795.1.43484 WP_003404795.1.43557 WP_003404795.1.43578 WP_003404795.1.43588 WP_003404795.1.43643 WP_003404795.1.43664 WP_003404795.1.43684 WP_003404795.1.43686 WP_003404795.1.43706 WP_003404795.1.43716 WP_003404795.1.4377 WP_003404795.1.43781 WP_003404795.1.43794 WP_003404795.1.43815 WP_003404795.1.43846 WP_003404795.1.43861 WP_003404795.1.43863 WP_003404795.1.43866 WP_003404795.1.43872 WP_003404795.1.43885 WP_003404795.1.43897 WP_003404795.1.4390 WP_003404795.1.43902 WP_003404795.1.43921 WP_003404795.1.43936 WP_003404795.1.43937 WP_003404795.1.43960 WP_003404795.1.43965 WP_003404795.1.4399 WP_003404795.1.43993 WP_003404795.1.43996 WP_003404795.1.44 WP_003404795.1.44001 WP_003404795.1.44008 WP_003404795.1.44016 WP_003404795.1.44033 WP_003404795.1.44037 WP_003404795.1.44041 WP_003404795.1.44070 WP_003404795.1.44071 WP_003404795.1.44076 WP_003404795.1.44104 WP_003404795.1.44111 WP_003404795.1.44124 WP_003404795.1.44169 WP_003404795.1.44219 WP_003404795.1.44237 WP_003404795.1.44277 WP_003404795.1.44279 WP_003404795.1.44336 WP_003404795.1.44355 WP_003404795.1.44358 WP_003404795.1.4438 WP_003404795.1.44390 WP_003404795.1.44392 WP_003404795.1.4441 WP_003404795.1.44415 WP_003404795.1.44464 WP_003404795.1.44466 WP_003404795.1.44489 WP_003404795.1.44492 WP_003404795.1.44494 WP_003404795.1.44500 WP_003404795.1.44519 WP_003404795.1.44526 WP_003404795.1.44532 WP_003404795.1.44534 WP_003404795.1.44562 WP_003404795.1.44589 WP_003404795.1.44597 WP_003404795.1.44600 WP_003404795.1.44602 WP_003404795.1.44615 WP_003404795.1.4464 WP_003404795.1.44651 WP_003404795.1.44659 WP_003404795.1.44665 WP_003404795.1.44694 WP_003404795.1.44700 WP_003404795.1.44713 WP_003404795.1.44735 WP_003404795.1.44740 WP_003404795.1.44757 WP_003404795.1.4476 WP_003404795.1.44761 WP_003404795.1.44767 WP_003404795.1.44776 WP_003404795.1.44779 WP_003404795.1.44786 WP_003404795.1.44864 WP_003404795.1.44901 WP_003404795.1.44908 WP_003404795.1.44913 WP_003404795.1.4492 WP_003404795.1.44939 WP_003404795.1.44979 WP_003404795.1.44981 WP_003404795.1.45002 WP_003404795.1.45011 WP_003404795.1.4504 WP_003404795.1.45066 WP_003404795.1.45081 WP_003404795.1.45113 WP_003404795.1.45129 WP_003404795.1.45135 WP_003404795.1.45147 WP_003404795.1.45168 WP_003404795.1.4517 WP_003404795.1.45181 WP_003404795.1.45185 WP_003404795.1.45192 WP_003404795.1.45200 WP_003404795.1.45205 WP_003404795.1.45211 WP_003404795.1.45249 WP_003404795.1.4526 WP_003404795.1.45286 WP_003404795.1.45326 WP_003404795.1.45347 WP_003404795.1.45374 WP_003404795.1.45390 WP_003404795.1.454 WP_003404795.1.45407 WP_003404795.1.45451 WP_003404795.1.45453 WP_003404795.1.45460 WP_003404795.1.45463 WP_003404795.1.45470 WP_003404795.1.45474 WP_003404795.1.45491 WP_003404795.1.45510 WP_003404795.1.45563 WP_003404795.1.45584 WP_003404795.1.45590 WP_003404795.1.45619 WP_003404795.1.45626 WP_003404795.1.45631 WP_003404795.1.45666 WP_003404795.1.45697 WP_003404795.1.4571 WP_003404795.1.45731 WP_003404795.1.45743 WP_003404795.1.45765 WP_003404795.1.45776 WP_003404795.1.45783 WP_003404795.1.45805 WP_003404795.1.45815 WP_003404795.1.45849 WP_003404795.1.45867 WP_003404795.1.45884 WP_003404795.1.4590 WP_003404795.1.45923 WP_003404795.1.45926 WP_003404795.1.45963 WP_003404795.1.45992 WP_003404795.1.46025 WP_003404795.1.46083 WP_003404795.1.46090 WP_003404795.1.46092 WP_003404795.1.46100 WP_003404795.1.46101 WP_003404795.1.46103 WP_003404795.1.46107 WP_003404795.1.46128 WP_003404795.1.46129 WP_003404795.1.46141 WP_003404795.1.46150 WP_003404795.1.46201 WP_003404795.1.46226 WP_003404795.1.4624 WP_003404795.1.46253 WP_003404795.1.46268 WP_003404795.1.46285 WP_003404795.1.46300 WP_003404795.1.46313 WP_003404795.1.46336 WP_003404795.1.46365 WP_003404795.1.46370 WP_003404795.1.46381 WP_003404795.1.46402 WP_003404795.1.46411 WP_003404795.1.4644 WP_003404795.1.46442 WP_003404795.1.46453 WP_003404795.1.46463 WP_003404795.1.46478 WP_003404795.1.46492 WP_003404795.1.46521 WP_003404795.1.4653 WP_003404795.1.46532 WP_003404795.1.46539 WP_003404795.1.46568 WP_003404795.1.46585 WP_003404795.1.46609 WP_003404795.1.46613 WP_003404795.1.46625 WP_003404795.1.46642 WP_003404795.1.46647 WP_003404795.1.46674 WP_003404795.1.46724 WP_003404795.1.46758 WP_003404795.1.46773 WP_003404795.1.46777 WP_003404795.1.46786 WP_003404795.1.46792 WP_003404795.1.46847 WP_003404795.1.46851 WP_003404795.1.4687 WP_003404795.1.46897 WP_003404795.1.46936 WP_003404795.1.46980 WP_003404795.1.47011 WP_003404795.1.47012 WP_003404795.1.47066 WP_003404795.1.47077 WP_003404795.1.47083 WP_003404795.1.47106 WP_003404795.1.47142 WP_003404795.1.47147 WP_003404795.1.47166 WP_003404795.1.47178 WP_003404795.1.47179 WP_003404795.1.47194 WP_003404795.1.47207 WP_003404795.1.47210 WP_003404795.1.47261 WP_003404795.1.47262 WP_003404795.1.47402 WP_003404795.1.47423 WP_003404795.1.47467 WP_003404795.1.47502 WP_003404795.1.4751 WP_003404795.1.47511 WP_003404795.1.47537 WP_003404795.1.47540 WP_003404795.1.47568 WP_003404795.1.47572 WP_003404795.1.47588 WP_003404795.1.47636 WP_003404795.1.4764 WP_003404795.1.47653 WP_003404795.1.47679 WP_003404795.1.47681 WP_003404795.1.47690 WP_003404795.1.4771 WP_003404795.1.47717 WP_003404795.1.47743 WP_003404795.1.47754 WP_003404795.1.47773 WP_003404795.1.47776 WP_003404795.1.47780 WP_003404795.1.47805 WP_003404795.1.47832 WP_003404795.1.47847 WP_003404795.1.47858 WP_003404795.1.47861 WP_003404795.1.47868 WP_003404795.1.47893 WP_003404795.1.47899 WP_003404795.1.479 WP_003404795.1.47912 WP_003404795.1.47913 WP_003404795.1.47926 WP_003404795.1.4794 WP_003404795.1.47943 WP_003404795.1.47944 WP_003404795.1.47959 WP_003404795.1.47974 WP_003404795.1.47993 WP_003404795.1.48004 WP_003404795.1.48039 WP_003404795.1.48050 WP_003404795.1.48084 WP_003404795.1.48097 WP_003404795.1.48101 WP_003404795.1.48109 WP_003404795.1.4813 WP_003404795.1.48130 WP_003404795.1.48135 WP_003404795.1.48143 WP_003404795.1.48152 WP_003404795.1.48155 WP_003404795.1.48170 WP_003404795.1.48173 WP_003404795.1.48177 WP_003404795.1.48185 WP_003404795.1.48204 WP_003404795.1.48219 WP_003404795.1.4823 WP_003404795.1.48240 WP_003404795.1.48256 WP_003404795.1.48264 WP_003404795.1.48287 WP_003404795.1.48330 WP_003404795.1.48333 WP_003404795.1.48348 WP_003404795.1.48354 WP_003404795.1.48372 WP_003404795.1.48383 WP_003404795.1.48388 WP_003404795.1.48419 WP_003404795.1.48423 WP_003404795.1.48443 WP_003404795.1.48450 WP_003404795.1.48462 WP_003404795.1.48543 WP_003404795.1.48550 WP_003404795.1.48605 WP_003404795.1.48618 WP_003404795.1.4863 WP_003404795.1.48648 WP_003404795.1.48658 WP_003404795.1.48666 WP_003404795.1.48687 WP_003404795.1.48779 WP_003404795.1.4878 WP_003404795.1.48798 WP_003404795.1.48802 WP_003404795.1.48826 WP_003404795.1.48831 WP_003404795.1.48843 WP_003404795.1.48857 WP_003404795.1.4890 WP_003404795.1.48946 WP_003404795.1.48979 WP_003404795.1.49017 WP_003404795.1.49048 WP_003404795.1.49059 WP_003404795.1.4906 WP_003404795.1.4907 WP_003404795.1.49103 WP_003404795.1.49110 WP_003404795.1.49111 WP_003404795.1.49112 WP_003404795.1.4919 WP_003404795.1.49251 WP_003404795.1.49254 WP_003404795.1.49263 WP_003404795.1.49291 WP_003404795.1.49296 WP_003404795.1.49335 WP_003404795.1.49337 WP_003404795.1.49419 WP_003404795.1.49426 WP_003404795.1.49437 WP_003404795.1.49439 WP_003404795.1.49474 WP_003404795.1.49506 WP_003404795.1.49516 WP_003404795.1.49523 WP_003404795.1.49526 WP_003404795.1.49532 WP_003404795.1.49588 WP_003404795.1.4959 WP_003404795.1.49678 WP_003404795.1.49687 WP_003404795.1.49699 WP_003404795.1.49709 WP_003404795.1.4971 WP_003404795.1.4972 WP_003404795.1.49736 WP_003404795.1.49746 WP_003404795.1.49764 WP_003404795.1.49773 WP_003404795.1.49796 WP_003404795.1.49814 WP_003404795.1.49815 WP_003404795.1.49816 WP_003404795.1.49839 WP_003404795.1.49857 WP_003404795.1.49878 WP_003404795.1.49880 WP_003404795.1.49944 WP_003404795.1.4999 WP_003404795.1.49990 WP_003404795.1.50068 WP_003404795.1.50077 WP_003404795.1.5008 WP_003404795.1.50081 WP_003404795.1.50122 WP_003404795.1.50126 WP_003404795.1.50149 WP_003404795.1.50162 WP_003404795.1.5018 WP_003404795.1.50194 WP_003404795.1.50218 WP_003404795.1.50235 WP_003404795.1.50249 WP_003404795.1.50265 WP_003404795.1.50271 WP_003404795.1.50324 WP_003404795.1.50347 WP_003404795.1.50372 WP_003404795.1.50398 WP_003404795.1.50407 WP_003404795.1.50444 WP_003404795.1.50466 WP_003404795.1.50472 WP_003404795.1.5048 WP_003404795.1.50498 WP_003404795.1.5050 WP_003404795.1.50540 WP_003404795.1.50554 WP_003404795.1.50557 WP_003404795.1.50601 WP_003404795.1.50610 WP_003404795.1.50632 WP_003404795.1.50633 WP_003404795.1.50642 WP_003404795.1.50655 WP_003404795.1.50659 WP_003404795.1.50683 WP_003404795.1.50689 WP_003404795.1.50692 WP_003404795.1.50714 WP_003404795.1.50729 WP_003404795.1.50756 WP_003404795.1.50784 WP_003404795.1.50794 WP_003404795.1.50841 WP_003404795.1.50860 WP_003404795.1.50877 WP_003404795.1.5096 WP_003404795.1.50981 WP_003404795.1.50987 WP_003404795.1.51003 WP_003404795.1.51009 WP_003404795.1.51037 WP_003404795.1.51074 WP_003404795.1.51082 WP_003404795.1.51101 WP_003404795.1.51116 WP_003404795.1.51149 WP_003404795.1.51156 WP_003404795.1.51157 WP_003404795.1.51213 WP_003404795.1.51232 WP_003404795.1.51239 WP_003404795.1.51247 WP_003404795.1.51266 WP_003404795.1.51279 WP_003404795.1.51291 WP_003404795.1.51294 WP_003404795.1.51301 WP_003404795.1.51329 WP_003404795.1.51391 WP_003404795.1.51422 WP_003404795.1.51445 WP_003404795.1.51455 WP_003404795.1.51466 WP_003404795.1.51468 WP_003404795.1.51478 WP_003404795.1.51497 WP_003404795.1.51520 WP_003404795.1.51593 WP_003404795.1.51628 WP_003404795.1.5164 WP_003404795.1.51647 WP_003404795.1.51660 WP_003404795.1.51696 WP_003404795.1.51721 WP_003404795.1.51788 WP_003404795.1.51795 WP_003404795.1.51801 WP_003404795.1.51817 WP_003404795.1.51819 WP_003404795.1.51854 WP_003404795.1.51923 WP_003404795.1.51942 WP_003404795.1.51948 WP_003404795.1.51963 WP_003404795.1.51969 WP_003404795.1.52000 WP_003404795.1.52001 WP_003404795.1.52003 WP_003404795.1.52006 WP_003404795.1.52036 WP_003404795.1.52038 WP_003404795.1.52046 WP_003404795.1.52059 WP_003404795.1.52069 WP_003404795.1.52082 WP_003404795.1.52102 WP_003404795.1.52106 WP_003404795.1.52166 WP_003404795.1.52168 WP_003404795.1.52173 WP_003404795.1.52178 WP_003404795.1.52206 WP_003404795.1.52216 WP_003404795.1.52238 WP_003404795.1.52241 WP_003404795.1.52280 WP_003404795.1.52314 WP_003404795.1.52385 WP_003404795.1.52390 WP_003404795.1.524 WP_003404795.1.52460 WP_003404795.1.52485 WP_003404795.1.52486 WP_003404795.1.52495 WP_003404795.1.52504 WP_003404795.1.52522 WP_003404795.1.52531 WP_003404795.1.52533 WP_003404795.1.52545 WP_003404795.1.52553 WP_003404795.1.52563 WP_003404795.1.52564 WP_003404795.1.52574 WP_003404795.1.52641 WP_003404795.1.52673 WP_003404795.1.52674 WP_003404795.1.52708 WP_003404795.1.52713 WP_003404795.1.52761 WP_003404795.1.52778 WP_003404795.1.52791 WP_003404795.1.52797 WP_003404795.1.52872 WP_003404795.1.52873 WP_003404795.1.52891 WP_003404795.1.52892 WP_003404795.1.52909 WP_003404795.1.52970 WP_003404795.1.52998 WP_003404795.1.53053 WP_003404795.1.53056 WP_003404795.1.5306 WP_003404795.1.53088 WP_003404795.1.5309 WP_003404795.1.531 WP_003404795.1.53117 WP_003404795.1.53118 WP_003404795.1.53142 WP_003404795.1.53157 WP_003404795.1.53167 WP_003404795.1.53200 WP_003404795.1.53204 WP_003404795.1.53213 WP_003404795.1.53217 WP_003404795.1.53226 WP_003404795.1.53229 WP_003404795.1.53230 WP_003404795.1.53237 WP_003404795.1.53254 WP_003404795.1.53257 WP_003404795.1.5327 WP_003404795.1.53276 WP_003404795.1.53278 WP_003404795.1.533 WP_003404795.1.53302 WP_003404795.1.53306 WP_003404795.1.5334 WP_003404795.1.5335 WP_003404795.1.53353 WP_003404795.1.53381 WP_003404795.1.53413 WP_003404795.1.53458 WP_003404795.1.53460 WP_003404795.1.53480 WP_003404795.1.53517 WP_003404795.1.53522 WP_003404795.1.53525 WP_003404795.1.53526 WP_003404795.1.53553 WP_003404795.1.53606 WP_003404795.1.53609 WP_003404795.1.53628 WP_003404795.1.53643 WP_003404795.1.53667 WP_003404795.1.53679 WP_003404795.1.53715 WP_003404795.1.53730 WP_003404795.1.53742 WP_003404795.1.53743 WP_003404795.1.53754 WP_003404795.1.53775 WP_003404795.1.53787 WP_003404795.1.53803 WP_003404795.1.53818 WP_003404795.1.53822 WP_003404795.1.53853 WP_003404795.1.53865 WP_003404795.1.53888 WP_003404795.1.53900 WP_003404795.1.53912 WP_003404795.1.53914 WP_003404795.1.53952 WP_003404795.1.5398 WP_003404795.1.5408 WP_003404795.1.54089 WP_003404795.1.54093 WP_003404795.1.54099 WP_003404795.1.54112 WP_003404795.1.54125 WP_003404795.1.54141 WP_003404795.1.54162 WP_003404795.1.54179 WP_003404795.1.54206 WP_003404795.1.54218 WP_003404795.1.54225 WP_003404795.1.54227 WP_003404795.1.54232 WP_003404795.1.54241 WP_003404795.1.54245 WP_003404795.1.54247 WP_003404795.1.54260 WP_003404795.1.54275 WP_003404795.1.54280 WP_003404795.1.5429 WP_003404795.1.54294 WP_003404795.1.54314 WP_003404795.1.54347 WP_003404795.1.54351 WP_003404795.1.54370 WP_003404795.1.54428 WP_003404795.1.54449 WP_003404795.1.54494 WP_003404795.1.54502 WP_003404795.1.54514 WP_003404795.1.54519 WP_003404795.1.5452 WP_003404795.1.54531 WP_003404795.1.54537 WP_003404795.1.54553 WP_003404795.1.54555 WP_003404795.1.54575 WP_003404795.1.54633 WP_003404795.1.54686 WP_003404795.1.54687 WP_003404795.1.54705 WP_003404795.1.54730 WP_003404795.1.54732 WP_003404795.1.5475 WP_003404795.1.54797 WP_003404795.1.54807 WP_003404795.1.54836 WP_003404795.1.54838 WP_003404795.1.54860 WP_003404795.1.54888 WP_003404795.1.54897 WP_003404795.1.54909 WP_003404795.1.54937 WP_003404795.1.54939 WP_003404795.1.54944 WP_003404795.1.54945 WP_003404795.1.54953 WP_003404795.1.54964 WP_003404795.1.55015 WP_003404795.1.55022 WP_003404795.1.55023 WP_003404795.1.55051 WP_003404795.1.55072 WP_003404795.1.55088 WP_003404795.1.55106 WP_003404795.1.55126 WP_003404795.1.55128 WP_003404795.1.55140 WP_003404795.1.55150 WP_003404795.1.55210 WP_003404795.1.55227 WP_003404795.1.55248 WP_003404795.1.55257 WP_003404795.1.55258 WP_003404795.1.55267 WP_003404795.1.55279 WP_003404795.1.55307 WP_003404795.1.55326 WP_003404795.1.55328 WP_003404795.1.5533 WP_003404795.1.55345 WP_003404795.1.55396 WP_003404795.1.55398 WP_003404795.1.55441 WP_003404795.1.55459 WP_003404795.1.55501 WP_003404795.1.55504 WP_003404795.1.55578 WP_003404795.1.55626 WP_003404795.1.55641 WP_003404795.1.5569 WP_003404795.1.55723 WP_003404795.1.55735 WP_003404795.1.5574 WP_003404795.1.55772 WP_003404795.1.55802 WP_003404795.1.55807 WP_003404795.1.55819 WP_003404795.1.55821 WP_003404795.1.5583 WP_003404795.1.55849 WP_003404795.1.55856 WP_003404795.1.55860 WP_003404795.1.55882 WP_003404795.1.55883 WP_003404795.1.55894 WP_003404795.1.55902 WP_003404795.1.5591 WP_003404795.1.55961 WP_003404795.1.55977 WP_003404795.1.55983 WP_003404795.1.56028 WP_003404795.1.56057 WP_003404795.1.56060 WP_003404795.1.56107 WP_003404795.1.56132 WP_003404795.1.56163 WP_003404795.1.56167 WP_003404795.1.56178 WP_003404795.1.56287 WP_003404795.1.56292 WP_003404795.1.56327 WP_003404795.1.56341 WP_003404795.1.56359 WP_003404795.1.56365 WP_003404795.1.56394 WP_003404795.1.56443 WP_003404795.1.56473 WP_003404795.1.56478 WP_003404795.1.56500 WP_003404795.1.56517 WP_003404795.1.56534 WP_003404795.1.5656 WP_003404795.1.56577 WP_003404795.1.56593 WP_003404795.1.56625 WP_003404795.1.56637 WP_003404795.1.56670 WP_003404795.1.56697 WP_003404795.1.567 WP_003404795.1.56701 WP_003404795.1.56709 WP_003404795.1.56729 WP_003404795.1.56743 WP_003404795.1.56755 WP_003404795.1.56764 WP_003404795.1.56769 WP_003404795.1.56770 WP_003404795.1.56795 WP_003404795.1.5681 WP_003404795.1.56827 WP_003404795.1.56839 WP_003404795.1.56863 WP_003404795.1.56868 WP_003404795.1.56869 WP_003404795.1.56915 WP_003404795.1.56926 WP_003404795.1.56961 WP_003404795.1.56971 WP_003404795.1.56972 WP_003404795.1.57023 WP_003404795.1.57035 WP_003404795.1.57077 WP_003404795.1.57087 WP_003404795.1.57094 WP_003404795.1.57134 WP_003404795.1.57151 WP_003404795.1.57169 WP_003404795.1.57208 WP_003404795.1.57212 WP_003404795.1.57230 WP_003404795.1.5724 WP_003404795.1.5725 WP_003404795.1.5727 WP_003404795.1.57273 WP_003404795.1.573 WP_003404795.1.57314 WP_003404795.1.57326 WP_003404795.1.57328 WP_003404795.1.57331 WP_003404795.1.57340 WP_003404795.1.57351 WP_003404795.1.57352 WP_003404795.1.57380 WP_003404795.1.57430 WP_003404795.1.5744 WP_003404795.1.57440 WP_003404795.1.5745 WP_003404795.1.57461 WP_003404795.1.57469 WP_003404795.1.57489 WP_003404795.1.575 WP_003404795.1.57509 WP_003404795.1.57519 WP_003404795.1.57525 WP_003404795.1.57551 WP_003404795.1.5758 WP_003404795.1.57596 WP_003404795.1.57604 WP_003404795.1.57616 WP_003404795.1.57617 WP_003404795.1.57619 WP_003404795.1.57627 WP_003404795.1.57642 WP_003404795.1.57658 WP_003404795.1.57667 WP_003404795.1.57675 WP_003404795.1.57689 WP_003404795.1.57708 WP_003404795.1.57794 WP_003404795.1.57821 WP_003404795.1.57825 WP_003404795.1.57843 WP_003404795.1.57906 WP_003404795.1.57924 WP_003404795.1.57926 WP_003404795.1.57930 WP_003404795.1.57957 WP_003404795.1.57960 WP_003404795.1.57964 WP_003404795.1.57991 WP_003404795.1.58000 WP_003404795.1.58086 WP_003404795.1.58101 WP_003404795.1.58103 WP_003404795.1.58108 WP_003404795.1.5811 WP_003404795.1.58121 WP_003404795.1.58145 WP_003404795.1.58164 WP_003404795.1.58174 WP_003404795.1.582 WP_003404795.1.58202 WP_003404795.1.58209 WP_003404795.1.58215 WP_003404795.1.5824 WP_003404795.1.58250 WP_003404795.1.58259 WP_003404795.1.58283 WP_003404795.1.58288 WP_003404795.1.5830 WP_003404795.1.58303 WP_003404795.1.58311 WP_003404795.1.58330 WP_003404795.1.58359 WP_003404795.1.58386 WP_003404795.1.58393 WP_003404795.1.58431 WP_003404795.1.5844 WP_003404795.1.58457 WP_003404795.1.58488 WP_003404795.1.58518 WP_003404795.1.58534 WP_003404795.1.58559 WP_003404795.1.58567 WP_003404795.1.58573 WP_003404795.1.58602 WP_003404795.1.58612 WP_003404795.1.58619 WP_003404795.1.58630 WP_003404795.1.5865 WP_003404795.1.58671 WP_003404795.1.58690 WP_003404795.1.58702 WP_003404795.1.58743 WP_003404795.1.58754 WP_003404795.1.5879 WP_003404795.1.5881 WP_003404795.1.58848 WP_003404795.1.58857 WP_003404795.1.58891 WP_003404795.1.58892 WP_003404795.1.5890 WP_003404795.1.58904 WP_003404795.1.58921 WP_003404795.1.58930 WP_003404795.1.58939 WP_003404795.1.58941 WP_003404795.1.58953 WP_003404795.1.58961 WP_003404795.1.5898 WP_003404795.1.59025 WP_003404795.1.59029 WP_003404795.1.59037 WP_003404795.1.59044 WP_003404795.1.59088 WP_003404795.1.59112 WP_003404795.1.59130 WP_003404795.1.5914 WP_003404795.1.59147 WP_003404795.1.59166 WP_003404795.1.59205 WP_003404795.1.59209 WP_003404795.1.59237 WP_003404795.1.59240 WP_003404795.1.59253 WP_003404795.1.59254 WP_003404795.1.59262 WP_003404795.1.59270 WP_003404795.1.5928 WP_003404795.1.59304 WP_003404795.1.59305 WP_003404795.1.59309 WP_003404795.1.59316 WP_003404795.1.59326 WP_003404795.1.59328 WP_003404795.1.59333 WP_003404795.1.59338 WP_003404795.1.59388 WP_003404795.1.59428 WP_003404795.1.59487 WP_003404795.1.59537 WP_003404795.1.59561 WP_003404795.1.59677 WP_003404795.1.59722 WP_003404795.1.59727 WP_003404795.1.59732 WP_003404795.1.59738 WP_003404795.1.59750 WP_003404795.1.59757 WP_003404795.1.59761 WP_003404795.1.59808 WP_003404795.1.59850 WP_003404795.1.59856 WP_003404795.1.59860 WP_003404795.1.59861 WP_003404795.1.5987 WP_003404795.1.59878 WP_003404795.1.59888 WP_003404795.1.59952 WP_003404795.1.5996 WP_003404795.1.59961 WP_003404795.1.59974 WP_003404795.1.6000 WP_003404795.1.60007 WP_003404795.1.60016 WP_003404795.1.6003 WP_003404795.1.60047 WP_003404795.1.6007 WP_003404795.1.60121 WP_003404795.1.60125 WP_003404795.1.60135 WP_003404795.1.60139 WP_003404795.1.60152 WP_003404795.1.60197 WP_003404795.1.6020 WP_003404795.1.60205 WP_003404795.1.60207 WP_003404795.1.60215 WP_003404795.1.60217 WP_003404795.1.60267 WP_003404795.1.60288 WP_003404795.1.60291 WP_003404795.1.60301 WP_003404795.1.60305 WP_003404795.1.60312 WP_003404795.1.60313 WP_003404795.1.60314 WP_003404795.1.60367 WP_003404795.1.60376 WP_003404795.1.60403 WP_003404795.1.60413 WP_003404795.1.60421 WP_003404795.1.60451 WP_003404795.1.60460 WP_003404795.1.60479 WP_003404795.1.60487 WP_003404795.1.60512 WP_003404795.1.60573 WP_003404795.1.60583 WP_003404795.1.60632 WP_003404795.1.60657 WP_003404795.1.60687 WP_003404795.1.60689 WP_003404795.1.60727 WP_003404795.1.60738 WP_003404795.1.60763 WP_003404795.1.6077 WP_003404795.1.60791 WP_003404795.1.60834 WP_003404795.1.60870 WP_003404795.1.60878 WP_003404795.1.60879 WP_003404795.1.60913 WP_003404795.1.60978 WP_003404795.1.61000 WP_003404795.1.61001 WP_003404795.1.61012 WP_003404795.1.61014 WP_003404795.1.61015 WP_003404795.1.61037 WP_003404795.1.61052 WP_003404795.1.61065 WP_003404795.1.61100 WP_003404795.1.61101 WP_003404795.1.61138 WP_003404795.1.61142 WP_003404795.1.61198 WP_003404795.1.612 WP_003404795.1.61234 WP_003404795.1.61256 WP_003404795.1.61281 WP_003404795.1.61314 WP_003404795.1.61321 WP_003404795.1.61326 WP_003404795.1.61328 WP_003404795.1.61368 WP_003404795.1.61391 WP_003404795.1.61406 WP_003404795.1.61420 WP_003404795.1.61422 WP_003404795.1.61425 WP_003404795.1.61428 WP_003404795.1.61469 WP_003404795.1.61494 WP_003404795.1.61522 WP_003404795.1.61552 WP_003404795.1.61557 WP_003404795.1.61567 WP_003404795.1.61571 WP_003404795.1.61573 WP_003404795.1.61584 WP_003404795.1.61586 WP_003404795.1.6159 WP_003404795.1.61592 WP_003404795.1.6160 WP_003404795.1.61614 WP_003404795.1.6163 WP_003404795.1.61655 WP_003404795.1.61665 WP_003404795.1.61669 WP_003404795.1.61682 WP_003404795.1.61692 WP_003404795.1.61719 WP_003404795.1.61728 WP_003404795.1.61750 WP_003404795.1.61754 WP_003404795.1.61755 WP_003404795.1.61757 WP_003404795.1.61778 WP_003404795.1.6179 WP_003404795.1.61793 WP_003404795.1.61816 WP_003404795.1.61842 WP_003404795.1.61850 WP_003404795.1.61862 WP_003404795.1.61865 WP_003404795.1.61868 WP_003404795.1.61911 WP_003404795.1.61925 WP_003404795.1.61941 WP_003404795.1.61953 WP_003404795.1.61979 WP_003404795.1.61986 WP_003404795.1.61987 WP_003404795.1.61998 WP_003404795.1.62021 WP_003404795.1.62087 WP_003404795.1.62089 WP_003404795.1.62101 WP_003404795.1.62104 WP_003404795.1.6211 WP_003404795.1.62132 WP_003404795.1.62162 WP_003404795.1.62225 WP_003404795.1.62230 WP_003404795.1.62238 WP_003404795.1.62249 WP_003404795.1.62270 WP_003404795.1.62281 WP_003404795.1.62307 WP_003404795.1.6231 WP_003404795.1.62359 WP_003404795.1.62360 WP_003404795.1.62371 WP_003404795.1.62379 WP_003404795.1.62395 WP_003404795.1.62408 WP_003404795.1.62449 WP_003404795.1.62468 WP_003404795.1.6248 WP_003404795.1.62508 WP_003404795.1.62565 WP_003404795.1.62594 WP_003404795.1.62606 WP_003404795.1.62616 WP_003404795.1.62666 WP_003404795.1.62687 WP_003404795.1.62715 WP_003404795.1.62730 WP_003404795.1.62738 WP_003404795.1.62761 WP_003404795.1.62766 WP_003404795.1.62786 WP_003404795.1.62813 WP_003404795.1.62839 WP_003404795.1.62841 WP_003404795.1.62936 WP_003404795.1.6294 WP_003404795.1.6295 WP_003404795.1.62962 WP_003404795.1.63007 WP_003404795.1.63019 WP_003404795.1.63032 WP_003404795.1.63037 WP_003404795.1.63064 WP_003404795.1.63066 WP_003404795.1.63072 WP_003404795.1.6308 WP_003404795.1.63081 WP_003404795.1.63096 WP_003404795.1.63106 WP_003404795.1.6314 WP_003404795.1.63144 WP_003404795.1.63154 WP_003404795.1.63160 WP_003404795.1.63161 WP_003404795.1.63166 WP_003404795.1.63175 WP_003404795.1.63194 WP_003404795.1.6322 WP_003404795.1.63222 WP_003404795.1.63247 WP_003404795.1.6328 WP_003404795.1.63291 WP_003404795.1.63312 WP_003404795.1.63317 WP_003404795.1.63331 WP_003404795.1.63373 WP_003404795.1.63384 WP_003404795.1.63403 WP_003404795.1.63424 WP_003404795.1.63428 WP_003404795.1.6345 WP_003404795.1.63464 WP_003404795.1.63483 WP_003404795.1.63502 WP_003404795.1.63504 WP_003404795.1.63522 WP_003404795.1.63530 WP_003404795.1.63538 WP_003404795.1.63564 WP_003404795.1.63567 WP_003404795.1.63596 WP_003404795.1.63600 WP_003404795.1.63623 WP_003404795.1.63624 WP_003404795.1.63625 WP_003404795.1.63627 WP_003404795.1.63654 WP_003404795.1.63662 WP_003404795.1.63711 WP_003404795.1.63734 WP_003404795.1.63807 WP_003404795.1.63844 WP_003404795.1.63888 WP_003404795.1.63913 WP_003404795.1.63915 WP_003404795.1.63918 WP_003404795.1.63961 WP_003404795.1.63970 WP_003404795.1.64000 WP_003404795.1.64027 WP_003404795.1.64058 WP_003404795.1.64065 WP_003404795.1.6407 WP_003404795.1.64082 WP_003404795.1.64091 WP_003404795.1.64102 WP_003404795.1.64104 WP_003404795.1.64119 WP_003404795.1.64169 WP_003404795.1.64219 WP_003404795.1.6422 WP_003404795.1.64222 WP_003404795.1.64223 WP_003404795.1.64228 WP_003404795.1.64235 WP_003404795.1.64249 WP_003404795.1.6427 WP_003404795.1.64278 WP_003404795.1.64287 WP_003404795.1.64414 WP_003404795.1.64419 WP_003404795.1.6443 WP_003404795.1.64463 WP_003404795.1.64480 WP_003404795.1.64497 WP_003404795.1.64506 WP_003404795.1.64511 WP_003404795.1.64513 WP_003404795.1.64514 WP_003404795.1.64515 WP_003404795.1.64522 WP_003404795.1.64526 WP_003404795.1.64543 WP_003404795.1.6456 WP_003404795.1.64567 WP_003404795.1.64588 WP_003404795.1.64589 WP_003404795.1.64594 WP_003404795.1.64595 WP_003404795.1.64608 WP_003404795.1.64619 WP_003404795.1.64629 WP_003404795.1.6464 WP_003404795.1.64664 WP_003404795.1.64669 WP_003404795.1.64672 WP_003404795.1.64680 WP_003404795.1.64682 WP_003404795.1.64727 WP_003404795.1.64729 WP_003404795.1.64774 WP_003404795.1.64776 WP_003404795.1.64802 WP_003404795.1.64832 WP_003404795.1.6486 WP_003404795.1.64870 WP_003404795.1.64898 WP_003404795.1.64922 WP_003404795.1.64924 WP_003404795.1.6493 WP_003404795.1.64937 WP_003404795.1.64941 WP_003404795.1.64966 WP_003404795.1.64973 WP_003404795.1.65001 WP_003404795.1.65026 WP_003404795.1.65053 WP_003404795.1.65070 WP_003404795.1.65079 WP_003404795.1.65102 WP_003404795.1.65157 WP_003404795.1.65181 WP_003404795.1.65212 WP_003404795.1.65229 WP_003404795.1.6523 WP_003404795.1.65253 WP_003404795.1.65289 WP_003404795.1.65291 WP_003404795.1.65315 WP_003404795.1.65329 WP_003404795.1.65359 WP_003404795.1.6536 WP_003404795.1.65374 WP_003404795.1.65386 WP_003404795.1.65414 WP_003404795.1.65416 WP_003404795.1.65433 WP_003404795.1.65455 WP_003404795.1.65467 WP_003404795.1.65488 WP_003404795.1.65529 WP_003404795.1.65539 WP_003404795.1.65583 WP_003404795.1.65612 WP_003404795.1.65623 WP_003404795.1.65635 WP_003404795.1.65637 WP_003404795.1.65648 WP_003404795.1.65683 WP_003404795.1.65686 WP_003404795.1.65688 WP_003404795.1.65707 WP_003404795.1.65733 WP_003404795.1.65746 WP_003404795.1.65747 WP_003404795.1.65759 WP_003404795.1.65816 WP_003404795.1.65830 WP_003404795.1.65858 WP_003404795.1.65862 WP_003404795.1.65869 WP_003404795.1.65893 WP_003404795.1.65929 WP_003404795.1.65932 WP_003404795.1.65958 WP_003404795.1.66004 WP_003404795.1.66013 WP_003404795.1.6606 WP_003404795.1.66089 WP_003404795.1.66149 WP_003404795.1.66151 WP_003404795.1.66229 WP_003404795.1.66276 WP_003404795.1.66293 WP_003404795.1.66297 WP_003404795.1.66323 WP_003404795.1.66325 WP_003404795.1.6633 WP_003404795.1.66334 WP_003404795.1.66355 WP_003404795.1.66367 WP_003404795.1.66394 WP_003404795.1.66396 WP_003404795.1.66451 WP_003404795.1.66455 WP_003404795.1.66457 WP_003404795.1.66460 WP_003404795.1.66464 WP_003404795.1.66466 WP_003404795.1.66487 WP_003404795.1.66504 WP_003404795.1.66544 WP_003404795.1.66558 WP_003404795.1.66580 WP_003404795.1.66582 WP_003404795.1.66612 WP_003404795.1.66615 WP_003404795.1.66617 WP_003404795.1.66635 WP_003404795.1.66656 WP_003404795.1.66663 WP_003404795.1.66675 WP_003404795.1.66715 WP_003404795.1.66718 WP_003404795.1.66762 WP_003404795.1.66776 WP_003404795.1.66808 WP_003404795.1.66817 WP_003404795.1.66819 WP_003404795.1.66826 WP_003404795.1.66830 WP_003404795.1.66842 WP_003404795.1.66868 WP_003404795.1.66878 WP_003404795.1.66880 WP_003404795.1.66893 WP_003404795.1.66961 WP_003404795.1.67005 WP_003404795.1.6704 WP_003404795.1.67044 WP_003404795.1.67061 WP_003404795.1.67089 WP_003404795.1.67098 WP_003404795.1.67146 WP_003404795.1.67170 WP_003404795.1.67197 WP_003404795.1.67198 WP_003404795.1.6720 WP_003404795.1.67207 WP_003404795.1.67218 WP_003404795.1.67220 WP_003404795.1.67225 WP_003404795.1.67231 WP_003404795.1.6724 WP_003404795.1.67257 WP_003404795.1.67298 WP_003404795.1.67307 WP_003404795.1.67324 WP_003404795.1.67332 WP_003404795.1.67346 WP_003404795.1.67354 WP_003404795.1.67360 WP_003404795.1.67381 WP_003404795.1.67396 WP_003404795.1.67417 WP_003404795.1.67422 WP_003404795.1.67453 WP_003404795.1.67459 WP_003404795.1.6746 WP_003404795.1.67473 WP_003404795.1.67481 WP_003404795.1.67482 WP_003404795.1.67496 WP_003404795.1.67499 WP_003404795.1.67516 WP_003404795.1.67523 WP_003404795.1.67536 WP_003404795.1.67575 WP_003404795.1.67587 WP_003404795.1.67598 WP_003404795.1.67600 WP_003404795.1.67602 WP_003404795.1.67630 WP_003404795.1.67679 WP_003404795.1.67692 WP_003404795.1.67744 WP_003404795.1.6775 WP_003404795.1.67750 WP_003404795.1.6777 WP_003404795.1.67809 WP_003404795.1.67816 WP_003404795.1.67844 WP_003404795.1.67848 WP_003404795.1.67870 WP_003404795.1.67888 WP_003404795.1.67915 WP_003404795.1.67945 WP_003404795.1.67949 WP_003404795.1.67980 WP_003404795.1.67982 WP_003404795.1.68022 WP_003404795.1.68029 WP_003404795.1.68037 WP_003404795.1.68038 WP_003404795.1.68045 WP_003404795.1.68057 WP_003404795.1.68083 WP_003404795.1.68088 WP_003404795.1.68106 WP_003404795.1.68110 WP_003404795.1.68153 WP_003404795.1.68164 WP_003404795.1.68169 WP_003404795.1.68193 WP_003404795.1.68212 WP_003404795.1.68227 WP_003404795.1.68243 WP_003404795.1.6825 WP_003404795.1.68297 WP_003404795.1.68309 WP_003404795.1.68325 WP_003404795.1.68329 WP_003404795.1.68340 WP_003404795.1.68384 WP_003404795.1.68388 WP_003404795.1.68429 WP_003404795.1.6843 WP_003404795.1.68433 WP_003404795.1.68444 WP_003404795.1.68465 WP_003404795.1.68484 WP_003404795.1.68518 WP_003404795.1.68569 WP_003404795.1.68576 WP_003404795.1.68580 WP_003404795.1.68586 WP_003404795.1.68623 WP_003404795.1.68624 WP_003404795.1.68637 WP_003404795.1.68646 WP_003404795.1.68672 WP_003404795.1.68684 WP_003404795.1.68704 WP_003404795.1.68708 WP_003404795.1.6872 WP_003404795.1.68730 WP_003404795.1.68734 WP_003404795.1.68748 WP_003404795.1.68754 WP_003404795.1.6876 WP_003404795.1.68761 WP_003404795.1.68763 WP_003404795.1.68766 WP_003404795.1.68774 WP_003404795.1.68796 WP_003404795.1.68824 WP_003404795.1.68832 WP_003404795.1.68833 WP_003404795.1.68841 WP_003404795.1.68859 WP_003404795.1.68876 WP_003404795.1.68906 WP_003404795.1.68916 WP_003404795.1.68923 WP_003404795.1.68945 WP_003404795.1.6896 WP_003404795.1.68981 WP_003404795.1.68984 WP_003404795.1.68997 WP_003404795.1.69008 WP_003404795.1.69076 WP_003404795.1.69079 WP_003404795.1.6908 WP_003404795.1.69082 WP_003404795.1.69178 WP_003404795.1.69181 WP_003404795.1.69208 WP_003404795.1.69231 WP_003404795.1.69256 WP_003404795.1.69311 WP_003404795.1.69315 WP_003404795.1.69322 WP_003404795.1.69342 WP_003404795.1.6935 WP_003404795.1.6936 WP_003404795.1.69369 WP_003404795.1.69374 WP_003404795.1.69398 WP_003404795.1.69401 WP_003404795.1.69426 WP_003404795.1.69427 WP_003404795.1.69429 WP_003404795.1.6949 WP_003404795.1.6951 WP_003404795.1.69511 WP_003404795.1.69526 WP_003404795.1.69528 WP_003404795.1.69547 WP_003404795.1.69573 WP_003404795.1.69581 WP_003404795.1.6960 WP_003404795.1.69617 WP_003404795.1.69634 WP_003404795.1.69647 WP_003404795.1.69659 WP_003404795.1.69673 WP_003404795.1.69682 WP_003404795.1.69684 WP_003404795.1.69686 WP_003404795.1.69707 WP_003404795.1.69709 WP_003404795.1.69723 WP_003404795.1.69736 WP_003404795.1.69778 WP_003404795.1.69800 WP_003404795.1.69802 WP_003404795.1.69845 WP_003404795.1.69870 WP_003404795.1.69873 WP_003404795.1.69898 WP_003404795.1.69913 WP_003404795.1.69925 WP_003404795.1.69931 WP_003404795.1.69938 WP_003404795.1.69955 WP_003404795.1.69957 WP_003404795.1.69981 WP_003404795.1.69990 WP_003404795.1.70 WP_003404795.1.70000 WP_003404795.1.70017 WP_003404795.1.70032 WP_003404795.1.70055 WP_003404795.1.70062 WP_003404795.1.70072 WP_003404795.1.70131 WP_003404795.1.70132 WP_003404795.1.7022 WP_003404795.1.70227 WP_003404795.1.70255 WP_003404795.1.70271 WP_003404795.1.70274 WP_003404795.1.7029 WP_003404795.1.70325 WP_003404795.1.70328 WP_003404795.1.70356 WP_003404795.1.70364 WP_003404795.1.70368 WP_003404795.1.70369 WP_003404795.1.70418 WP_003404795.1.70422 WP_003404795.1.70435 WP_003404795.1.70444 WP_003404795.1.70463 WP_003404795.1.70471 WP_003404795.1.70480 WP_003404795.1.70494 WP_003404795.1.70498 WP_003404795.1.70505 WP_003404795.1.70525 WP_003404795.1.70573 WP_003404795.1.70577 WP_003404795.1.70610 WP_003404795.1.70615 WP_003404795.1.70618 WP_003404795.1.70622 WP_003404795.1.70626 WP_003404795.1.70668 WP_003404795.1.70699 WP_003404795.1.70704 WP_003404795.1.70729 WP_003404795.1.70757 WP_003404795.1.70782 WP_003404795.1.70796 WP_003404795.1.70834 WP_003404795.1.7084 WP_003404795.1.70840 WP_003404795.1.70864 WP_003404795.1.70871 WP_003404795.1.70915 WP_003404795.1.70955 WP_003404795.1.70958 WP_003404795.1.70964 WP_003404795.1.70976 WP_003404795.1.71015 WP_003404795.1.71026 WP_003404795.1.71063 WP_003404795.1.71076 WP_003404795.1.71083 WP_003404795.1.7111 WP_003404795.1.71118 WP_003404795.1.71128 WP_003404795.1.7113 WP_003404795.1.71187 WP_003404795.1.71191 WP_003404795.1.71255 WP_003404795.1.71258 WP_003404795.1.71259 WP_003404795.1.71289 WP_003404795.1.71326 WP_003404795.1.71329 WP_003404795.1.71331 WP_003404795.1.71344 WP_003404795.1.71390 WP_003404795.1.71414 WP_003404795.1.71440 WP_003404795.1.71457 WP_003404795.1.7146 WP_003404795.1.71464 WP_003404795.1.71490 WP_003404795.1.71492 WP_003404795.1.71509 WP_003404795.1.71516 WP_003404795.1.71517 WP_003404795.1.71527 WP_003404795.1.71532 WP_003404795.1.71545 WP_003404795.1.71546 WP_003404795.1.71569 WP_003404795.1.71604 WP_003404795.1.71621 WP_003404795.1.71630 WP_003404795.1.71638 WP_003404795.1.71654 WP_003404795.1.71664 WP_003404795.1.71665 WP_003404795.1.71683 WP_003404795.1.71701 WP_003404795.1.71718 WP_003404795.1.71731 WP_003404795.1.71778 WP_003404795.1.71781 WP_003404795.1.71803 WP_003404795.1.71820 WP_003404795.1.71847 WP_003404795.1.7185 WP_003404795.1.71851 WP_003404795.1.71871 WP_003404795.1.71909 WP_003404795.1.71957 WP_003404795.1.71970 WP_003404795.1.72047 WP_003404795.1.72061 WP_003404795.1.72062 WP_003404795.1.72072 WP_003404795.1.72111 WP_003404795.1.72122 WP_003404795.1.72128 WP_003404795.1.72143 WP_003404795.1.7216 WP_003404795.1.72168 WP_003404795.1.72179 WP_003404795.1.72209 WP_003404795.1.72218 WP_003404795.1.72219 WP_003404795.1.72227 WP_003404795.1.7224 WP_003404795.1.72268 WP_003404795.1.72332 WP_003404795.1.72380 WP_003404795.1.72401 WP_003404795.1.72405 WP_003404795.1.72420 WP_003404795.1.72441 WP_003404795.1.72451 WP_003404795.1.72452 WP_003404795.1.72457 WP_003404795.1.72459 WP_003404795.1.72460 WP_003404795.1.72466 WP_003404795.1.72487 WP_003404795.1.72488 WP_003404795.1.72492 WP_003404795.1.72506 WP_003404795.1.72543 WP_003404795.1.7256 WP_003404795.1.72576 WP_003404795.1.72578 WP_003404795.1.72585 WP_003404795.1.72591 WP_003404795.1.72592 WP_003404795.1.72640 WP_003404795.1.7266 WP_003404795.1.72661 WP_003404795.1.72684 WP_003404795.1.72739 WP_003404795.1.72744 WP_003404795.1.72755 WP_003404795.1.72759 WP_003404795.1.72784 WP_003404795.1.72792 WP_003404795.1.72826 WP_003404795.1.72831 WP_003404795.1.72852 WP_003404795.1.72853 WP_003404795.1.72879 WP_003404795.1.72880 WP_003404795.1.72938 WP_003404795.1.72954 WP_003404795.1.72957 WP_003404795.1.72959 WP_003404795.1.72973 WP_003404795.1.72982 WP_003404795.1.72988 WP_003404795.1.72993 WP_003404795.1.73006 WP_003404795.1.73013 WP_003404795.1.73025 WP_003404795.1.73028 WP_003404795.1.73042 WP_003404795.1.73045 WP_003404795.1.73092 WP_003404795.1.73118 WP_003404795.1.7312 WP_003404795.1.73127 WP_003404795.1.73134 WP_003404795.1.73150 WP_003404795.1.73154 WP_003404795.1.73163 WP_003404795.1.73182 WP_003404795.1.73205 WP_003404795.1.7321 WP_003404795.1.73310 WP_003404795.1.73365 WP_003404795.1.73391 WP_003404795.1.73404 WP_003404795.1.73424 WP_003404795.1.73436 WP_003404795.1.73445 WP_003404795.1.73453 WP_003404795.1.73465 WP_003404795.1.73466 WP_003404795.1.73470 WP_003404795.1.73471 WP_003404795.1.73478 WP_003404795.1.73482 WP_003404795.1.73507 WP_003404795.1.73532 WP_003404795.1.73550 WP_003404795.1.73564 WP_003404795.1.73623 WP_003404795.1.73629 WP_003404795.1.73644 WP_003404795.1.7366 WP_003404795.1.73661 WP_003404795.1.7368 WP_003404795.1.73688 WP_003404795.1.73723 WP_003404795.1.73744 WP_003404795.1.73750 WP_003404795.1.73760 WP_003404795.1.7379 WP_003404795.1.73813 WP_003404795.1.73840 WP_003404795.1.73876 WP_003404795.1.7389 WP_003404795.1.73986 WP_003404795.1.74016 WP_003404795.1.74039 WP_003404795.1.74083 WP_003404795.1.74101 WP_003404795.1.74107 WP_003404795.1.74120 WP_003404795.1.74129 WP_003404795.1.74144 WP_003404795.1.7417 WP_003404795.1.74190 WP_003404795.1.74210 WP_003404795.1.7423 WP_003404795.1.74259 WP_003404795.1.74262 WP_003404795.1.74269 WP_003404795.1.74282 WP_003404795.1.74291 WP_003404795.1.74296 WP_003404795.1.74304 WP_003404795.1.7432 WP_003404795.1.74347 WP_003404795.1.7436 WP_003404795.1.74378 WP_003404795.1.74382 WP_003404795.1.74395 WP_003404795.1.74400 WP_003404795.1.74401 WP_003404795.1.74432 WP_003404795.1.74442 WP_003404795.1.74477 WP_003404795.1.74487 WP_003404795.1.74499 WP_003404795.1.74504 WP_003404795.1.74511 WP_003404795.1.74525 WP_003404795.1.74551 WP_003404795.1.74555 WP_003404795.1.74628 WP_003404795.1.74641 WP_003404795.1.74653 WP_003404795.1.74660 WP_003404795.1.74683 WP_003404795.1.7469 WP_003404795.1.74725 WP_003404795.1.74760 WP_003404795.1.74786 WP_003404795.1.74809 WP_003404795.1.74820 WP_003404795.1.74870 WP_003404795.1.74881 WP_003404795.1.74888 WP_003404795.1.74952 WP_003404795.1.7496 WP_003404795.1.74988 WP_003404795.1.75043 WP_003404795.1.75045 WP_003404795.1.75055 WP_003404795.1.75078 WP_003404795.1.75081 WP_003404795.1.75120 WP_003404795.1.75163 WP_003404795.1.75188 WP_003404795.1.75200 WP_003404795.1.75202 WP_003404795.1.75234 WP_003404795.1.75239 WP_003404795.1.75250 WP_003404795.1.75263 WP_003404795.1.75281 WP_003404795.1.75342 WP_003404795.1.7535 WP_003404795.1.75376 WP_003404795.1.75391 WP_003404795.1.75395 WP_003404795.1.75441 WP_003404795.1.75510 WP_003404795.1.75581 WP_003404795.1.75598 WP_003404795.1.75635 WP_003404795.1.75645 WP_003404795.1.75665 WP_003404795.1.75671 WP_003404795.1.75741 WP_003404795.1.75749 WP_003404795.1.75772 WP_003404795.1.75774 WP_003404795.1.75811 WP_003404795.1.75833 WP_003404795.1.7585 WP_003404795.1.75864 WP_003404795.1.75868 WP_003404795.1.75878 WP_003404795.1.75927 WP_003404795.1.75946 WP_003404795.1.75968 WP_003404795.1.75974 WP_003404795.1.76007 WP_003404795.1.76016 WP_003404795.1.76032 WP_003404795.1.76037 WP_003404795.1.7604 WP_003404795.1.76045 WP_003404795.1.76052 WP_003404795.1.76058 WP_003404795.1.76064 WP_003404795.1.76110 WP_003404795.1.76126 WP_003404795.1.76133 WP_003404795.1.76138 WP_003404795.1.76157 WP_003404795.1.76172 WP_003404795.1.76177 WP_003404795.1.76183 WP_003404795.1.76209 WP_003404795.1.76239 WP_003404795.1.76272 WP_003404795.1.76277 WP_003404795.1.76280 WP_003404795.1.76281 WP_003404795.1.76291 WP_003404795.1.76297 WP_003404795.1.76360 WP_003404795.1.76379 WP_003404795.1.76403 WP_003404795.1.76413 WP_003404795.1.76414 WP_003404795.1.76427 WP_003404795.1.76436 WP_003404795.1.76442 WP_003404795.1.76456 WP_003404795.1.76521 WP_003404795.1.76533 WP_003404795.1.76616 WP_003404795.1.76625 WP_003404795.1.76629 WP_003404795.1.76635 WP_003404795.1.76638 WP_003404795.1.76639 WP_003404795.1.76640 WP_003404795.1.76644 WP_003404795.1.76677 WP_003404795.1.76678 WP_003404795.1.76679 WP_003404795.1.76734 WP_003404795.1.76744 WP_003404795.1.76750 WP_003404795.1.76754 WP_003404795.1.76757 WP_003404795.1.76781 WP_003404795.1.76818 WP_003404795.1.76824 WP_003404795.1.76835 WP_003404795.1.76873 WP_003404795.1.76881 WP_003404795.1.76888 WP_003404795.1.76900 WP_003404795.1.7691 WP_003404795.1.76947 WP_003404795.1.76954 WP_003404795.1.76955 WP_003404795.1.76963 WP_003404795.1.76976 WP_003404795.1.770 WP_003404795.1.77000 WP_003404795.1.77008 WP_003404795.1.77021 WP_003404795.1.77056 WP_003404795.1.77065 WP_003404795.1.77075 WP_003404795.1.77093 WP_003404795.1.77107 WP_003404795.1.77115 WP_003404795.1.77118 WP_003404795.1.77125 WP_003404795.1.77141 WP_003404795.1.77142 WP_003404795.1.77166 WP_003404795.1.77250 WP_003404795.1.77252 WP_003404795.1.77260 WP_003404795.1.77266 WP_003404795.1.77280 WP_003404795.1.77285 WP_003404795.1.77312 WP_003404795.1.77348 WP_003404795.1.77351 WP_003404795.1.77352 WP_003404795.1.77361 WP_003404795.1.774 WP_003404795.1.7740 WP_003404795.1.77404 WP_003404795.1.77425 WP_003404795.1.77463 WP_003404795.1.77474 WP_003404795.1.7748 WP_003404795.1.77484 WP_003404795.1.77491 WP_003404795.1.77499 WP_003404795.1.77510 WP_003404795.1.77530 WP_003404795.1.77554 WP_003404795.1.77559 WP_003404795.1.77599 WP_003404795.1.77605 WP_003404795.1.7762 WP_003404795.1.77627 WP_003404795.1.77649 WP_003404795.1.77654 WP_003404795.1.7766 WP_003404795.1.77667 WP_003404795.1.77704 WP_003404795.1.77706 WP_003404795.1.77726 WP_003404795.1.7778 WP_003404795.1.77790 WP_003404795.1.77809 WP_003404795.1.77820 WP_003404795.1.77843 WP_003404795.1.77855 WP_003404795.1.77865 WP_003404795.1.77868 WP_003404795.1.77879 WP_003404795.1.77890 WP_003404795.1.77909 WP_003404795.1.77911 WP_003404795.1.77931 WP_003404795.1.77984 WP_003404795.1.78020 WP_003404795.1.78024 WP_003404795.1.78075 WP_003404795.1.78084 WP_003404795.1.78086 WP_003404795.1.7809 WP_003404795.1.78098 WP_003404795.1.78105 WP_003404795.1.78113 WP_003404795.1.78136 WP_003404795.1.78162 WP_003404795.1.7817 WP_003404795.1.78200 WP_003404795.1.78216 WP_003404795.1.78236 WP_003404795.1.78238 WP_003404795.1.78322 WP_003404795.1.78338 WP_003404795.1.7836 WP_003404795.1.78360 WP_003404795.1.78386 WP_003404795.1.78429 WP_003404795.1.78435 WP_003404795.1.7844 WP_003404795.1.78459 WP_003404795.1.78488 WP_003404795.1.7849 WP_003404795.1.78499 WP_003404795.1.785 WP_003404795.1.78516 WP_003404795.1.78524 WP_003404795.1.78526 WP_003404795.1.78538 WP_003404795.1.78544 WP_003404795.1.78545 WP_003404795.1.78547 WP_003404795.1.78574 WP_003404795.1.78580 WP_003404795.1.7860 WP_003404795.1.78620 WP_003404795.1.78646 WP_003404795.1.78648 WP_003404795.1.78649 WP_003404795.1.78655 WP_003404795.1.78657 WP_003404795.1.78659 WP_003404795.1.7869 WP_003404795.1.78692 WP_003404795.1.78760 WP_003404795.1.78766 WP_003404795.1.78776 WP_003404795.1.78778 WP_003404795.1.78784 WP_003404795.1.78788 WP_003404795.1.78790 WP_003404795.1.78848 WP_003404795.1.78860 WP_003404795.1.7887 WP_003404795.1.78884 WP_003404795.1.78932 WP_003404795.1.78969 WP_003404795.1.78977 WP_003404795.1.78980 WP_003404795.1.79005 WP_003404795.1.79016 WP_003404795.1.79033 WP_003404795.1.79064 WP_003404795.1.79066 WP_003404795.1.79068 WP_003404795.1.79077 WP_003404795.1.79095 WP_003404795.1.79112 WP_003404795.1.79122 WP_003404795.1.79145 WP_003404795.1.79152 WP_003404795.1.79163 WP_003404795.1.79182 WP_003404795.1.79198 WP_003404795.1.79213 WP_003404795.1.79218 WP_003404795.1.79268 WP_003404795.1.79273 WP_003404795.1.79278 WP_003404795.1.79290 WP_003404795.1.79319 WP_003404795.1.79325 WP_003404795.1.79326 WP_003404795.1.7933 WP_003404795.1.79330 WP_003404795.1.79339 WP_003404795.1.79394 WP_003404795.1.79399 WP_003404795.1.79413 WP_003404795.1.79422 WP_003404795.1.79445 WP_003404795.1.79447 WP_003404795.1.79455 WP_003404795.1.79471 WP_003404795.1.79480 WP_003404795.1.79482 WP_003404795.1.79488 WP_003404795.1.79500 WP_003404795.1.79502 WP_003404795.1.79508 WP_003404795.1.79514 WP_003404795.1.79561 WP_003404795.1.79565 WP_003404795.1.79578 WP_003404795.1.79588 WP_003404795.1.79598 WP_003404795.1.79615 WP_003404795.1.79684 WP_003404795.1.79698 WP_003404795.1.797 WP_003404795.1.79744 WP_003404795.1.79784 WP_003404795.1.79802 WP_003404795.1.79806 WP_003404795.1.79819 WP_003404795.1.79826 WP_003404795.1.79828 WP_003404795.1.79851 WP_003404795.1.79853 WP_003404795.1.79863 WP_003404795.1.79881 WP_003404795.1.79885 WP_003404795.1.79898 WP_003404795.1.7990 WP_003404795.1.79900 WP_003404795.1.79913 WP_003404795.1.79918 WP_003404795.1.79947 WP_003404795.1.79948 WP_003404795.1.7995 WP_003404795.1.7997 WP_003404795.1.80004 WP_003404795.1.80015 WP_003404795.1.80022 WP_003404795.1.80030 WP_003404795.1.80054 WP_003404795.1.80084 WP_003404795.1.80099 WP_003404795.1.80129 WP_003404795.1.80177 WP_003404795.1.80234 WP_003404795.1.8026 WP_003404795.1.80275 WP_003404795.1.8029 WP_003404795.1.80299 WP_003404795.1.80300 WP_003404795.1.80304 WP_003404795.1.80326 WP_003404795.1.80351 WP_003404795.1.8037 WP_003404795.1.80370 WP_003404795.1.80387 WP_003404795.1.80399 WP_003404795.1.8044 WP_003404795.1.80451 WP_003404795.1.80458 WP_003404795.1.80461 WP_003404795.1.80490 WP_003404795.1.80503 WP_003404795.1.80507 WP_003404795.1.80552 WP_003404795.1.80576 WP_003404795.1.80588 WP_003404795.1.80599 WP_003404795.1.8060 WP_003404795.1.80624 WP_003404795.1.80636 WP_003404795.1.80673 WP_003404795.1.80711 WP_003404795.1.80714 WP_003404795.1.80743 WP_003404795.1.80784 WP_003404795.1.80815 WP_003404795.1.80853 WP_003404795.1.80918 WP_003404795.1.8093 WP_003404795.1.80967 WP_003404795.1.8097 WP_003404795.1.80988 WP_003404795.1.81007 WP_003404795.1.81013 WP_003404795.1.8105 WP_003404795.1.81059 WP_003404795.1.81063 WP_003404795.1.81066 WP_003404795.1.81075 WP_003404795.1.81091 WP_003404795.1.81119 WP_003404795.1.81125 WP_003404795.1.81136 WP_003404795.1.8114 WP_003404795.1.81189 WP_003404795.1.81192 WP_003404795.1.812 WP_003404795.1.81230 WP_003404795.1.81249 WP_003404795.1.81250 WP_003404795.1.81264 WP_003404795.1.8128 WP_003404795.1.81287 WP_003404795.1.81297 WP_003404795.1.8138 WP_003404795.1.81407 WP_003404795.1.8143 WP_003404795.1.81439 WP_003404795.1.81465 WP_003404795.1.81505 WP_003404795.1.81529 WP_003404795.1.81538 WP_003404795.1.81541 WP_003404795.1.81560 WP_003404795.1.81561 WP_003404795.1.81567 WP_003404795.1.81583 WP_003404795.1.81686 WP_003404795.1.81712 WP_003404795.1.81720 WP_003404795.1.81731 WP_003404795.1.81774 WP_003404795.1.81788 WP_003404795.1.81809 WP_003404795.1.81820 WP_003404795.1.81850 WP_003404795.1.81883 WP_003404795.1.81891 WP_003404795.1.81911 WP_003404795.1.81918 WP_003404795.1.82011 WP_003404795.1.82048 WP_003404795.1.82069 WP_003404795.1.82071 WP_003404795.1.82108 WP_003404795.1.82136 WP_003404795.1.82142 WP_003404795.1.8215 WP_003404795.1.82158 WP_003404795.1.8217 WP_003404795.1.82209 WP_003404795.1.82210 WP_003404795.1.82228 WP_003404795.1.82236 WP_003404795.1.82251 WP_003404795.1.82271 WP_003404795.1.82305 WP_003404795.1.82307 WP_003404795.1.82309 WP_003404795.1.82317 WP_003404795.1.8232 WP_003404795.1.82346 WP_003404795.1.82374 WP_003404795.1.82385 WP_003404795.1.82429 WP_003404795.1.82460 WP_003404795.1.82462 WP_003404795.1.82483 WP_003404795.1.82494 WP_003404795.1.82531 WP_003404795.1.82546 WP_003404795.1.82549 WP_003404795.1.82577 WP_003404795.1.82592 WP_003404795.1.82597 WP_003404795.1.82598 WP_003404795.1.82625 WP_003404795.1.82642 WP_003404795.1.82651 WP_003404795.1.82653 WP_003404795.1.82681 WP_003404795.1.82685 WP_003404795.1.8271 WP_003404795.1.82712 WP_003404795.1.8273 WP_003404795.1.82743 WP_003404795.1.82757 WP_003404795.1.82774 WP_003404795.1.82836 WP_003404795.1.82860 WP_003404795.1.82871 WP_003404795.1.82892 WP_003404795.1.82935 WP_003404795.1.82957 WP_003404795.1.82973 WP_003404795.1.82981 WP_003404795.1.82983 WP_003404795.1.83004 WP_003404795.1.83009 WP_003404795.1.83044 WP_003404795.1.83065 WP_003404795.1.83074 WP_003404795.1.83110 WP_003404795.1.83146 WP_003404795.1.83149 WP_003404795.1.83159 WP_003404795.1.8317 WP_003404795.1.83173 WP_003404795.1.83181 WP_003404795.1.83182 WP_003404795.1.83191 WP_003404795.1.83197 WP_003404795.1.83212 WP_003404795.1.8326 WP_003404795.1.83262 WP_003404795.1.83268 WP_003404795.1.83273 WP_003404795.1.83309 WP_003404795.1.83332 WP_003404795.1.83334 WP_003404795.1.83341 WP_003404795.1.83349 WP_003404795.1.8335 WP_003404795.1.83353 WP_003404795.1.83367 WP_003404795.1.83380 WP_003404795.1.83381 WP_003404795.1.83389 WP_003404795.1.83408 WP_003404795.1.83409 WP_003404795.1.83435 WP_003404795.1.83470 WP_003404795.1.83524 WP_003404795.1.83526 WP_003404795.1.8358 WP_003404795.1.83589 WP_003404795.1.83601 WP_003404795.1.83611 WP_003404795.1.83638 WP_003404795.1.83648 WP_003404795.1.83656 WP_003404795.1.83667 WP_003404795.1.83689 WP_003404795.1.83692 WP_003404795.1.83704 WP_003404795.1.83705 WP_003404795.1.83766 WP_003404795.1.83793 WP_003404795.1.83794 WP_003404795.1.83802 WP_003404795.1.83805 WP_003404795.1.83839 WP_003404795.1.83842 WP_003404795.1.83850 WP_003404795.1.83861 WP_003404795.1.83884 WP_003404795.1.83920 WP_003404795.1.83929 WP_003404795.1.83930 WP_003404795.1.83975 WP_003404795.1.83991 WP_003404795.1.8400 WP_003404795.1.84027 WP_003404795.1.8404 WP_003404795.1.84057 WP_003404795.1.84070 WP_003404795.1.8409 WP_003404795.1.84112 WP_003404795.1.84146 WP_003404795.1.8415 WP_003404795.1.84176 WP_003404795.1.84186 WP_003404795.1.84192 WP_003404795.1.84228 WP_003404795.1.8424 WP_003404795.1.84244 WP_003404795.1.84259 WP_003404795.1.8426 WP_003404795.1.84277 WP_003404795.1.84287 WP_003404795.1.8434 WP_003404795.1.84388 WP_003404795.1.84408 WP_003404795.1.84409 WP_003404795.1.84438 WP_003404795.1.84460 WP_003404795.1.84488 WP_003404795.1.84504 WP_003404795.1.84525 WP_003404795.1.84620 WP_003404795.1.84623 WP_003404795.1.84641 WP_003404795.1.84655 WP_003404795.1.84666 WP_003404795.1.84670 WP_003404795.1.84739 WP_003404795.1.84748 WP_003404795.1.84766 WP_003404795.1.84772 WP_003404795.1.84774 WP_003404795.1.848 WP_003404795.1.84812 WP_003404795.1.84836 WP_003404795.1.84839 WP_003404795.1.84846 WP_003404795.1.84873 WP_003404795.1.84911 WP_003404795.1.84938 WP_003404795.1.84968 WP_003404795.1.84973 WP_003404795.1.84981 WP_003404795.1.84985 WP_003404795.1.8503 WP_003404795.1.85038 WP_003404795.1.85041 WP_003404795.1.85043 WP_003404795.1.8505 WP_003404795.1.85074 WP_003404795.1.8509 WP_003404795.1.8512 WP_003404795.1.85148 WP_003404795.1.8518 WP_003404795.1.8522 WP_003404795.1.85242 WP_003404795.1.85276 WP_003404795.1.85281 WP_003404795.1.85284 WP_003404795.1.85314 WP_003404795.1.85319 WP_003404795.1.85330 WP_003404795.1.85341 WP_003404795.1.85346 WP_003404795.1.8535 WP_003404795.1.85363 WP_003404795.1.85371 WP_003404795.1.85377 WP_003404795.1.85387 WP_003404795.1.85399 WP_003404795.1.85458 WP_003404795.1.8546 WP_003404795.1.85464 WP_003404795.1.85478 WP_003404795.1.85480 WP_003404795.1.85488 WP_003404795.1.85495 WP_003404795.1.85551 WP_003404795.1.85557 WP_003404795.1.85577 WP_003404795.1.85597 WP_003404795.1.85599 WP_003404795.1.85610 WP_003404795.1.8563 WP_003404795.1.85648 WP_003404795.1.85679 WP_003404795.1.85704 WP_003404795.1.85717 WP_003404795.1.85727 WP_003404795.1.85737 WP_003404795.1.85763 WP_003404795.1.85808 WP_003404795.1.85819 WP_003404795.1.85820 WP_003404795.1.85823 WP_003404795.1.85832 WP_003404795.1.8586 WP_003404795.1.85872 WP_003404795.1.85894 WP_003404795.1.85909 WP_003404795.1.85913 WP_003404795.1.85953 WP_003404795.1.85986 WP_003404795.1.86000 WP_003404795.1.86024 WP_003404795.1.86025 WP_003404795.1.86032 WP_003404795.1.86048 WP_003404795.1.86052 WP_003404795.1.86067 WP_003404795.1.86103 WP_003404795.1.86122 WP_003404795.1.86124 WP_003404795.1.86160 WP_003404795.1.86164 WP_003404795.1.86168 WP_003404795.1.86190 WP_003404795.1.86204 WP_003404795.1.86208 WP_003404795.1.86235 WP_003404795.1.86249 WP_003404795.1.86260 WP_003404795.1.86290 WP_003404795.1.863 WP_003404795.1.86327 WP_003404795.1.86334 WP_003404795.1.86337 WP_003404795.1.86368 WP_003404795.1.86377 WP_003404795.1.86425 WP_003404795.1.86459 WP_003404795.1.8649 WP_003404795.1.86499 WP_003404795.1.86520 WP_003404795.1.86561 WP_003404795.1.86568 WP_003404795.1.86575 WP_003404795.1.86584 WP_003404795.1.86605 WP_003404795.1.86626 WP_003404795.1.86648 WP_003404795.1.8666 WP_003404795.1.86684 WP_003404795.1.86696 WP_003404795.1.86705 WP_003404795.1.86718 WP_003404795.1.86725 WP_003404795.1.86757 WP_003404795.1.86766 WP_003404795.1.86801 WP_003404795.1.86814 WP_003404795.1.86820 WP_003404795.1.86825 WP_003404795.1.86834 WP_003404795.1.8685 WP_003404795.1.86851 WP_003404795.1.86855 WP_003404795.1.86867 WP_003404795.1.86877 WP_003404795.1.86883 WP_003404795.1.8689 WP_003404795.1.86892 WP_003404795.1.86933 WP_003404795.1.86941 WP_003404795.1.86950 WP_003404795.1.86962 WP_003404795.1.86963 WP_003404795.1.86979 WP_003404795.1.8700 WP_003404795.1.87001 WP_003404795.1.87002 WP_003404795.1.87031 WP_003404795.1.87116 WP_003404795.1.87117 WP_003404795.1.8714 WP_003404795.1.87162 WP_003404795.1.87178 WP_003404795.1.87191 WP_003404795.1.87201 WP_003404795.1.87209 WP_003404795.1.87240 WP_003404795.1.87266 WP_003404795.1.87273 WP_003404795.1.87275 WP_003404795.1.8733 WP_003404795.1.87345 WP_003404795.1.87369 WP_003404795.1.8737 WP_003404795.1.87401 WP_003404795.1.87404 WP_003404795.1.87409 WP_003404795.1.87444 WP_003404795.1.87446 WP_003404795.1.87459 WP_003404795.1.87472 WP_003404795.1.87489 WP_003404795.1.87494 WP_003404795.1.87496 WP_003404795.1.87582 WP_003404795.1.87588 WP_003404795.1.87617 WP_003404795.1.87619 WP_003404795.1.87620 WP_003404795.1.87634 WP_003404795.1.87643 WP_003404795.1.8765 WP_003404795.1.87650 WP_003404795.1.87654 WP_003404795.1.87658 WP_003404795.1.87665 WP_003404795.1.87676 WP_003404795.1.87677 WP_003404795.1.87684 WP_003404795.1.87692 WP_003404795.1.87707 WP_003404795.1.87732 WP_003404795.1.87784 WP_003404795.1.87796 WP_003404795.1.87809 WP_003404795.1.87817 WP_003404795.1.87827 WP_003404795.1.87831 WP_003404795.1.87835 WP_003404795.1.87837 WP_003404795.1.87866 WP_003404795.1.8789 WP_003404795.1.87911 WP_003404795.1.87924 WP_003404795.1.87951 WP_003404795.1.87955 WP_003404795.1.87956 WP_003404795.1.87991 WP_003404795.1.88 WP_003404795.1.88037 WP_003404795.1.88039 WP_003404795.1.88072 WP_003404795.1.88077 WP_003404795.1.88121 WP_003404795.1.88180 WP_003404795.1.88191 WP_003404795.1.88205 WP_003404795.1.88217 WP_003404795.1.88219 WP_003404795.1.88245 WP_003404795.1.88253 WP_003404795.1.88294 WP_003404795.1.88315 WP_003404795.1.88316 WP_003404795.1.88320 WP_003404795.1.88338 WP_003404795.1.8840 WP_003404795.1.88437 WP_003404795.1.88453 WP_003404795.1.88469 WP_003404795.1.88489 WP_003404795.1.88507 WP_003404795.1.88521 WP_003404795.1.88530 WP_003404795.1.88537 WP_003404795.1.88541 WP_003404795.1.88592 WP_003404795.1.88616 WP_003404795.1.88618 WP_003404795.1.8862 WP_003404795.1.88625 WP_003404795.1.88634 WP_003404795.1.88649 WP_003404795.1.8870 WP_003404795.1.88737 WP_003404795.1.88756 WP_003404795.1.888 WP_003404795.1.88824 WP_003404795.1.88886 WP_003404795.1.88965 WP_003404795.1.88985 WP_003404795.1.8902 WP_003404795.1.89025 WP_003404795.1.89041 WP_003404795.1.89046 WP_003404795.1.89082 WP_003404795.1.89162 WP_003404795.1.8917 WP_003404795.1.89193 WP_003404795.1.89205 WP_003404795.1.89207 WP_003404795.1.89225 WP_003404795.1.8925 WP_003404795.1.89277 WP_003404795.1.89286 WP_003404795.1.89293 WP_003404795.1.89320 WP_003404795.1.8935 WP_003404795.1.89371 WP_003404795.1.89378 WP_003404795.1.89392 WP_003404795.1.89406 WP_003404795.1.8943 WP_003404795.1.89451 WP_003404795.1.89453 WP_003404795.1.89473 WP_003404795.1.89475 WP_003404795.1.89483 WP_003404795.1.895 WP_003404795.1.89513 WP_003404795.1.89517 WP_003404795.1.89522 WP_003404795.1.8954 WP_003404795.1.89543 WP_003404795.1.89567 WP_003404795.1.8957 WP_003404795.1.89572 WP_003404795.1.89589 WP_003404795.1.89607 WP_003404795.1.89613 WP_003404795.1.89625 WP_003404795.1.89648 WP_003404795.1.8967 WP_003404795.1.89670 WP_003404795.1.89676 WP_003404795.1.89729 WP_003404795.1.89739 WP_003404795.1.89762 WP_003404795.1.8977 WP_003404795.1.89802 WP_003404795.1.89808 WP_003404795.1.8982 WP_003404795.1.89829 WP_003404795.1.89831 WP_003404795.1.89844 WP_003404795.1.89849 WP_003404795.1.8989 WP_003404795.1.89901 WP_003404795.1.89903 WP_003404795.1.89909 WP_003404795.1.89922 WP_003404795.1.89926 WP_003404795.1.89963 WP_003404795.1.89971 WP_003404795.1.8998 WP_003404795.1.89987 WP_003404795.1.900 WP_003404795.1.90048 WP_003404795.1.9007 WP_003404795.1.90080 WP_003404795.1.90130 WP_003404795.1.90134 WP_003404795.1.90137 WP_003404795.1.90157 WP_003404795.1.90184 WP_003404795.1.90199 WP_003404795.1.90231 WP_003404795.1.90245 WP_003404795.1.90308 WP_003404795.1.90322 WP_003404795.1.90328 WP_003404795.1.90372 WP_003404795.1.90439 WP_003404795.1.90481 WP_003404795.1.90499 WP_003404795.1.9050 WP_003404795.1.90527 WP_003404795.1.90550 WP_003404795.1.90560 WP_003404795.1.90612 WP_003404795.1.90640 WP_003404795.1.90672 WP_003404795.1.90687 WP_003404795.1.90691 WP_003404795.1.90711 WP_003404795.1.90722 WP_003404795.1.90744 WP_003404795.1.9075 WP_003404795.1.90756 WP_003404795.1.90767 WP_003404795.1.90771 WP_003404795.1.90785 WP_003404795.1.90788 WP_003404795.1.90800 WP_003404795.1.90810 WP_003404795.1.90816 WP_003404795.1.90819 WP_003404795.1.9082 WP_003404795.1.90831 WP_003404795.1.90884 WP_003404795.1.90899 WP_003404795.1.90906 WP_003404795.1.90958 WP_003404795.1.90976 WP_003404795.1.90977 WP_003404795.1.90987 WP_003404795.1.9102 WP_003404795.1.91026 WP_003404795.1.91032 WP_003404795.1.91043 WP_003404795.1.91053 WP_003404795.1.91082 WP_003404795.1.91106 WP_003404795.1.91112 WP_003404795.1.91144 WP_003404795.1.91151 WP_003404795.1.91157 WP_003404795.1.91167 WP_003404795.1.91169 WP_003404795.1.91192 WP_003404795.1.91201 WP_003404795.1.91207 WP_003404795.1.91208 WP_003404795.1.91211 WP_003404795.1.91214 WP_003404795.1.91230 WP_003404795.1.91244 WP_003404795.1.91251 WP_003404795.1.91260 WP_003404795.1.91265 WP_003404795.1.9128 WP_003404795.1.91284 WP_003404795.1.91294 WP_003404795.1.91303 WP_003404795.1.91322 WP_003404795.1.91352 WP_003404795.1.91386 WP_003404795.1.9139 WP_003404795.1.91398 WP_003404795.1.91411 WP_003404795.1.91430 WP_003404795.1.91436 WP_003404795.1.91483 WP_003404795.1.91496 WP_003404795.1.91507 WP_003404795.1.91508 WP_003404795.1.91576 WP_003404795.1.91589 WP_003404795.1.91694 WP_003404795.1.91695 WP_003404795.1.91713 WP_003404795.1.91716 WP_003404795.1.91717 WP_003404795.1.91728 WP_003404795.1.91743 WP_003404795.1.91759 WP_003404795.1.91784 WP_003404795.1.91785 WP_003404795.1.91786 WP_003404795.1.91802 WP_003404795.1.91822 WP_003404795.1.91828 WP_003404795.1.9189 WP_003404795.1.91896 WP_003404795.1.9190 WP_003404795.1.91915 WP_003404795.1.91931 WP_003404795.1.91937 WP_003404795.1.91944 WP_003404795.1.91953 WP_003404795.1.91957 WP_003404795.1.91976 WP_003404795.1.91978 WP_003404795.1.92021 WP_003404795.1.92083 WP_003404795.1.92127 WP_003404795.1.92144 WP_003404795.1.92150 WP_003404795.1.92153 WP_003404795.1.92190 WP_003404795.1.92192 WP_003404795.1.92200 WP_003404795.1.92220 WP_003404795.1.92221 WP_003404795.1.92222 WP_003404795.1.92273 WP_003404795.1.92289 WP_003404795.1.9229 WP_003404795.1.92294 WP_003404795.1.92300 WP_003404795.1.92317 WP_003404795.1.92334 WP_003404795.1.92338 WP_003404795.1.92345 WP_003404795.1.92356 WP_003404795.1.92364 WP_003404795.1.92380 WP_003404795.1.92416 WP_003404795.1.92428 WP_003404795.1.92447 WP_003404795.1.92456 WP_003404795.1.92467 WP_003404795.1.92471 WP_003404795.1.92490 WP_003404795.1.92508 WP_003404795.1.9251 WP_003404795.1.92511 WP_003404795.1.92523 WP_003404795.1.92527 WP_003404795.1.92536 WP_003404795.1.92592 WP_003404795.1.92597 WP_003404795.1.92603 WP_003404795.1.92606 WP_003404795.1.92610 WP_003404795.1.92613 WP_003404795.1.9263 WP_003404795.1.9265 WP_003404795.1.92650 WP_003404795.1.92660 WP_003404795.1.92677 WP_003404795.1.92685 WP_003404795.1.92689 WP_003404795.1.92690 WP_003404795.1.92706 WP_003404795.1.92714 WP_003404795.1.92736 WP_003404795.1.9274 WP_003404795.1.92752 WP_003404795.1.92760 WP_003404795.1.92777 WP_003404795.1.92803 WP_003404795.1.92833 WP_003404795.1.92856 WP_003404795.1.92881 WP_003404795.1.92892 WP_003404795.1.92907 WP_003404795.1.92908 WP_003404795.1.9291 WP_003404795.1.92917 WP_003404795.1.92996 WP_003404795.1.93006 WP_003404795.1.93008 WP_003404795.1.93009 WP_003404795.1.93015 WP_003404795.1.93043 WP_003404795.1.9307 WP_003404795.1.93083 WP_003404795.1.93097 WP_003404795.1.93137 WP_003404795.1.93192 WP_003404795.1.93199 WP_003404795.1.93203 WP_003404795.1.93212 WP_003404795.1.93234 WP_003404795.1.93245 WP_003404795.1.93257 WP_003404795.1.93265 WP_003404795.1.93297 WP_003404795.1.93320 WP_003404795.1.93328 WP_003404795.1.93337 WP_003404795.1.93343 WP_003404795.1.93349 WP_003404795.1.93363 WP_003404795.1.93377 WP_003404795.1.9338 WP_003404795.1.93407 WP_003404795.1.93417 WP_003404795.1.93419 WP_003404795.1.93426 WP_003404795.1.9344 WP_003404795.1.93443 WP_003404795.1.93447 WP_003404795.1.93470 WP_003404795.1.93483 WP_003404795.1.93487 WP_003404795.1.93495 WP_003404795.1.93499 WP_003404795.1.93516 WP_003404795.1.93536 WP_003404795.1.93544 WP_003404795.1.93555 WP_003404795.1.93560 WP_003404795.1.93564 WP_003404795.1.9357 WP_003404795.1.93573 WP_003404795.1.93576 WP_003404795.1.93588 WP_003404795.1.9363 WP_003404795.1.93645 WP_003404795.1.93649 WP_003404795.1.93677 WP_003404795.1.9368 WP_003404795.1.93689 WP_003404795.1.93693 WP_003404795.1.93698 WP_003404795.1.93706 WP_003404795.1.9371 WP_003404795.1.93792 WP_003404795.1.93823 WP_003404795.1.93871 WP_003404795.1.9388 WP_003404795.1.93894 WP_003404795.1.93903 WP_003404795.1.93907 WP_003404795.1.93913 WP_003404795.1.93946 WP_003404795.1.93950 WP_003404795.1.93953 WP_003404795.1.93954 WP_003404795.1.93988 WP_003404795.1.9407 WP_003404795.1.94143 WP_003404795.1.94154 WP_003404795.1.94184 WP_003404795.1.94204 WP_003404795.1.94205 WP_003404795.1.94226 WP_003404795.1.94231 WP_003404795.1.94256 WP_003404795.1.94261 WP_003404795.1.94281 WP_003404795.1.94292 WP_003404795.1.94297 WP_003404795.1.9431 WP_003404795.1.94326 WP_003404795.1.94339 WP_003404795.1.94392 WP_003404795.1.94416 WP_003404795.1.94421 WP_003404795.1.94456 WP_003404795.1.94470 WP_003404795.1.94480 WP_003404795.1.94495 WP_003404795.1.94511 WP_003404795.1.94512 WP_003404795.1.94525 WP_003404795.1.94528 WP_003404795.1.94564 WP_003404795.1.946 WP_003404795.1.94602 WP_003404795.1.94623 WP_003404795.1.94629 WP_003404795.1.9465 WP_003404795.1.94673 WP_003404795.1.94730 WP_003404795.1.94736 WP_003404795.1.94776 WP_003404795.1.9478 WP_003404795.1.94834 WP_003404795.1.94852 WP_003404795.1.94872 WP_003404795.1.9488 WP_003404795.1.94902 WP_003404795.1.94916 WP_003404795.1.94979 WP_003404795.1.94994 WP_003404795.1.94996 WP_003404795.1.94998 WP_003404795.1.95007 WP_003404795.1.95010 WP_003404795.1.95015 WP_003404795.1.95034 WP_003404795.1.95068 WP_003404795.1.95081 WP_003404795.1.95082 WP_003404795.1.9509 WP_003404795.1.95096 WP_003404795.1.95112 WP_003404795.1.95138 WP_003404795.1.9514 WP_003404795.1.95179 WP_003404795.1.95188 WP_003404795.1.95190 WP_003404795.1.95234 WP_003404795.1.95241 WP_003404795.1.95257 WP_003404795.1.95279 WP_003404795.1.9531 WP_003404795.1.95335 WP_003404795.1.95344 WP_003404795.1.9535 WP_003404795.1.95370 WP_003404795.1.95392 WP_003404795.1.95416 WP_003404795.1.95417 WP_003404795.1.95454 WP_003404795.1.95455 WP_003404795.1.95491 WP_003404795.1.95497 WP_003404795.1.95508 WP_003404795.1.95509 WP_003404795.1.95529 WP_003404795.1.95556 WP_003404795.1.95557 WP_003404795.1.95565 WP_003404795.1.95578 WP_003404795.1.95580 WP_003404795.1.95585 WP_003404795.1.95643 WP_003404795.1.95679 WP_003404795.1.95685 WP_003404795.1.957 WP_003404795.1.95724 WP_003404795.1.95727 WP_003404795.1.95730 WP_003404795.1.95735 WP_003404795.1.95758 WP_003404795.1.95772 WP_003404795.1.95797 WP_003404795.1.95839 WP_003404795.1.9585 WP_003404795.1.9590 WP_003404795.1.95902 WP_003404795.1.95908 WP_003404795.1.95924 WP_003404795.1.95926 WP_003404795.1.95953 WP_003404795.1.95958 WP_003404795.1.95964 WP_003404795.1.95973 WP_003404795.1.96006 WP_003404795.1.9602 WP_003404795.1.96036 WP_003404795.1.96062 WP_003404795.1.96065 WP_003404795.1.96098 WP_003404795.1.96146 WP_003404795.1.96166 WP_003404795.1.96171 WP_003404795.1.96182 WP_003404795.1.96204 WP_003404795.1.96230 WP_003404795.1.96235 WP_003404795.1.96242 WP_003404795.1.96245 WP_003404795.1.96254 WP_003404795.1.96259 WP_003404795.1.96286 WP_003404795.1.96313 WP_003404795.1.96318 WP_003404795.1.96345 WP_003404795.1.96360 WP_003404795.1.96373 WP_003404795.1.96456 WP_003404795.1.96486 WP_003404795.1.96569 WP_003404795.1.96573 WP_003404795.1.96575 WP_003404795.1.96576 WP_003404795.1.96611 WP_003404795.1.96621 WP_003404795.1.9667 WP_003404795.1.96681 WP_003404795.1.96726 WP_003404795.1.96733 WP_003404795.1.96742 WP_003404795.1.96754 WP_003404795.1.9678 WP_003404795.1.96832 WP_003404795.1.9685 WP_003404795.1.97008 WP_003404795.1.97009 WP_003404795.1.97056 WP_003404795.1.97084 WP_003404795.1.97087 WP_003404795.1.97094 WP_003404795.1.97096 WP_003404795.1.97099 WP_003404795.1.97108 WP_003404795.1.97113 WP_003404795.1.97122 WP_003404795.1.97127 WP_003404795.1.97129 WP_003404795.1.97136 WP_003404795.1.9716 WP_003404795.1.97176 WP_003404795.1.97222 WP_003404795.1.97223 WP_003404795.1.97237 WP_003404795.1.97242 WP_003404795.1.97270 WP_003404795.1.97283 WP_003404795.1.97296 WP_003404795.1.97321 WP_003404795.1.97325 WP_003404795.1.97330 WP_003404795.1.97366 WP_003404795.1.97376 WP_003404795.1.97380 WP_003404795.1.9739 WP_003404795.1.97462 WP_003404795.1.97517 WP_003404795.1.97519 WP_003404795.1.97535 WP_003404795.1.97540 WP_003404795.1.97545 WP_003404795.1.97546 WP_003404795.1.97550 WP_003404795.1.97568 WP_003404795.1.97577 WP_003404795.1.97584 WP_003404795.1.9759 WP_003404795.1.97591 WP_003404795.1.97596 WP_003404795.1.97609 WP_003404795.1.97618 WP_003404795.1.9763 WP_003404795.1.97669 WP_003404795.1.97673 WP_003404795.1.97700 WP_003404795.1.97701 WP_003404795.1.9773 WP_003404795.1.97730 WP_003404795.1.97740 WP_003404795.1.97751 WP_003404795.1.97754 WP_003404795.1.97797 WP_003404795.1.9782 WP_003404795.1.9784 WP_003404795.1.97888 WP_003404795.1.9790 WP_003404795.1.9795 WP_003404795.1.97951 WP_003404795.1.97958 WP_003404795.1.97966 WP_003404795.1.97977 WP_003404795.1.97979 WP_003404795.1.97995 WP_003404795.1.98018 WP_003404795.1.98034 WP_003404795.1.98052 WP_003404795.1.98071 WP_003404795.1.98072 WP_003404795.1.98113 WP_003404795.1.98114 WP_003404795.1.98128 WP_003404795.1.98181 WP_003404795.1.98188 WP_003404795.1.98189 WP_003404795.1.98213 WP_003404795.1.98225 WP_003404795.1.98291 WP_003404795.1.98335 WP_003404795.1.98350 WP_003404795.1.98395 WP_003404795.1.98412 WP_003404795.1.98441 WP_003404795.1.98443 WP_003404795.1.98462 WP_003404795.1.9848 WP_003404795.1.98482 WP_003404795.1.98486 WP_003404795.1.98488 WP_003404795.1.98503 WP_003404795.1.98516 WP_003404795.1.98524 WP_003404795.1.98536 WP_003404795.1.98541 WP_003404795.1.98566 WP_003404795.1.98576 WP_003404795.1.98590 WP_003404795.1.98594 WP_003404795.1.98599 WP_003404795.1.98629 WP_003404795.1.98645 WP_003404795.1.98646 WP_003404795.1.98649 WP_003404795.1.98656 WP_003404795.1.9867 WP_003404795.1.98674 WP_003404795.1.98697 WP_003404795.1.98701 WP_003404795.1.98739 WP_003404795.1.98749 WP_003404795.1.98765 WP_003404795.1.98770 WP_003404795.1.98777 WP_003404795.1.98802 WP_003404795.1.98838 WP_003404795.1.98850 WP_003404795.1.98906 WP_003404795.1.98935 WP_003404795.1.98948 WP_003404795.1.98953 WP_003404795.1.98984 WP_003404795.1.99000 WP_003404795.1.99023 WP_003404795.1.99030 WP_003404795.1.99037 WP_003404795.1.99055 WP_003404795.1.99062 WP_003404795.1.99086 WP_003404795.1.99115 WP_003404795.1.99117 WP_003404795.1.99161 WP_003404795.1.99176 WP_003404795.1.99205 WP_003404795.1.99211 WP_003404795.1.99216 WP_003404795.1.99222 WP_003404795.1.99251 WP_003404795.1.99269 WP_003404795.1.99294 WP_003404795.1.99316 WP_003404795.1.99322 WP_003404795.1.99328 WP_003404795.1.99365 WP_003404795.1.99368 WP_003404795.1.99379 WP_003404795.1.99396 WP_003404795.1.99402 WP_003404795.1.99404 WP_003404795.1.99419 WP_003404795.1.99438 WP_003404795.1.99460 WP_003404795.1.99468 WP_003404795.1.99513 WP_003404795.1.99529 WP_003404795.1.99548 WP_003404795.1.99572 WP_003404795.1.99575 WP_003404795.1.99578 WP_003404795.1.99605 WP_003404795.1.99609 WP_003404795.1.99617 WP_003404795.1.99635 WP_003404795.1.99650 WP_003404795.1.99672 WP_003404795.1.99701 WP_003404795.1.99711 WP_003404795.1.99716 WP_003404795.1.99740 WP_003404795.1.99745 WP_003404795.1.99749 WP_003404795.1.9976 WP_003404795.1.99798 WP_003404795.1.99817 WP_003404795.1.99832 WP_003404795.1.99847 WP_003404795.1.99852 WP_003404795.1.99886 WP_003404795.1.99897 WP_003404795.1.99899 WP_003404795.1.99915 WP_003404795.1.9993 WP_003404795.1.99982 WP_003404795.1.99991 gi|148660716|ref|YP_001282239.1| gi|392385647|ref|YP_005307276.1| 233413.Mb0962c 336982.TBFG_10955 410289.BCG_0991c 419947.MRA_0945 478434.TBMG_03052 561275.JTY_0961 83331.MT0964 83332.Rv0937c gi|494699329|ref|YP_007964811.1| gi|544161525|ref|YP_002160996.2| gi|385997718|ref|YP_005916016.1| gi|392433476|ref|YP_006474520.1| gi|121636862|ref|YP_977085.1| gi|15840360|ref|NP_335397.1| gi|15608077|ref|NP_215452.1| gi|479054888|ref|YP_007350694.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]