SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|258541800|ref|YP_003187233.1| from Acetobacter pasteurianus IFO 3283-01

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|258541800|ref|YP_003187233.1|
Domain Number 1 Region: 600-1049
Classification Level Classification E-value
Superfamily ALDH-like 1.96e-120
Family ALDH-like 0.000000928
Further Details:      
 
Domain Number 2 Region: 214-562
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 3.73e-115
Family Proline dehydrohenase domain of bifunctional PutA protein 0.000000000653
Further Details:      
 
Domain Number 3 Region: 45-213
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 2.22e-56
Family N-terminal domain of bifunctional PutA protein 0.00000378
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|258541800|ref|YP_003187233.1|
Sequence length 1241
Comment bifunctional proline dehydrogenase/pyrroline-5-carboxylate dehydrogenase [Acetobacter pasteurianus IFO 3283-01]
Sequence
MSGGNNHYEAKTTCTHGRPGSGSPIRNEKPMSSTDTFAPDFASRTPLRQAIIEAMRRPEA
QCVETLTPDATLTEAQNGSVASMAAKLAEALRARRSPGLVETLVQEFSLSSTEGVALMCL
AEALLRIPDVATRDALIQDKIGESNWLSHVARGKPLFANAAAWGLALTGKLVTEHDEGTL
ASSLLNFAERTSKPIIRKAVDAAMRLMGEQFVLGQTIDQARKNSAKLEAVGFSYSYDMLG
EAAFTAHDAERYRQDYINAINTIGRSATGNNVYDRPGISIKLSALHPRYARAQYDRVMGE
LLPVVQELTLLARKYDIGLNIDAEETERLDVSLDILEALCATPGLEGWNGIGFVVQAYGK
RCPYVLDYIIDLARRTNRRIMVRLVKGAYWDSEIKKAQVEGMADFPVYTRKCHTDISYIA
CARKLLNARDVIFPQFATHNARTLSTIYTLAGEKFELGSYEFQCLHGMGEPLYKQVVGAD
KFNRPCRIYAPVGTHETLLAYLVRRLLENGANSSFVNQIGDSAIPLSSLIENPIDVARCY
TPYGAPHTEIRNPRDLFAPERINSAGVDLADDKVLSALATGIKDAPQTWEASPMVVGVKK
KGAFRPVTNPADRRDVVGKVSYATPDVVRKAVDAAQKGQQDWANRSPAERADILQKASDI
LEERTDDLLALLGREAGKSLPNAVAEVREAVDFLRYYGATIRRDFDNTTHKPLGIVTCIS
PWNFPLAIFIGQIAAALAAGNVVLAKPAEETPLVAAVAVGILQEAGVPPAALQLLTGEGD
VGAAAVADERVMGVMFTGSTTVAQIINRQLLERRTATGQPVPFVAETGGQNAMIVDSSAL
AEQVVADVLASAFDSAGQRCSALRVLCVQEDCADHVLAMLRGAMRELRIGNPAHLSCDVG
PVITEEAAANITAHVNAFKARKAPVMALPVPEACANGSYVPPTLIEVLNIREIGPEVFGP
VLHVLRFERDKMEELLLEINDTGYGLTFGLHTRLDSTIKSVLSQVEAGNLYVNRNTIGAV
VGVQPFGGRGLSGTGPKAGGPLILRRLLSEAPTVAQIVRGRTMPEMAQWTDWLREKGESK
AAQIAGNLARLPLVGGEITLPGPVGEQNIYRLSARGNVLCVPITLAGLYDQISLALAGGN
TALVLAEEELTGWLDRLPDILRQAIRPVASATALPCSILLGEDDNAIFRSARRTLAEANG
PIVSAFVTGTTLPSVEVVLEEQSRSINTTAAGGNASLMTLN
Download sequence
Identical sequences C7JEM3
gi|258541800|ref|YP_003187233.1| gi|384118589|ref|YP_005501213.1| gi|384041721|ref|YP_005480465.1| gi|384056578|ref|YP_005489245.1| gi|384053346|ref|YP_005486440.1| gi|384059219|ref|YP_005498347.1| 634452.APA01_07050 WP_012812642.1.36695 WP_012812642.1.38618 WP_012812642.1.45580 WP_012812642.1.55019 WP_012812642.1.65311 WP_012812642.1.71918 WP_012812642.1.88241 WP_012812642.1.96488 WP_012812642.1.99323 gi|384062513|ref|YP_005483155.1| gi|384050236|ref|YP_005477299.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]