SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227818298|ref|YP_002822269.1| from Sinorhizobium fredii NGR234

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227818298|ref|YP_002822269.1|
Domain Number 1 Region: 47-138
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.7e-17
Family Voltage-gated potassium channels 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227818298|ref|YP_002822269.1|
Sequence length 150
Comment hypothetical protein NGR_b00430 [Sinorhizobium fredii NGR234]
Sequence
MILRLAIAGGLIAATVTIQAFFMSAGLRAFRQMEKDRPDFLSHYPTLVTVAWVIYLIIPI
LFDVCLWAAFYYLAQALPSFEDALYFSTVTFTTVGYGDIVLDRDWRQVATFEAINGWIIF
GWATALMMAVIQRLYFRTDPQAMDDGDPKG
Download sequence
Identical sequences C3KMU3
gi|227818298|ref|YP_002822269.1|NC_012586 394.NGR_b00430 gi|227818298|ref|YP_002822269.1| YP_002822269.1.63916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]