SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227820075|ref|YP_002824046.1| from Sinorhizobium fredii NGR234

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227820075|ref|YP_002824046.1|
Domain Number 1 Region: 17-29,70-305
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.06e-29
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227820075|ref|YP_002824046.1|
Sequence length 380
Comment poly-gamma-glutamate synthesis protein [Sinorhizobium fredii NGR234]
Sequence
MTATSERFSGASPREGTIRLFLCGDVMTGRGIDQVLPAPSDPILYEDYIRSARDYVRLAE
KANGPIPAPMDPALVWGVARDECDRAQPDLRVINLETAITRSKDHAPKGINYRMSPENAS
CLAAFGVDCCVLANNHVLDWGVAGLFDTLATLDRLRITTAGAGRDLDEASKHAAFDIGAE
QRVLLFALAIPTSGVPPGWAAGRGRAGVNFLPSLDRLCTAGLVENIRHSKRPRDVAVVSV
HWGPNWGYHVRAAQREFAHALIDEADVSIVHGHSSHHPKAIEVYRNRLILYGCGDFINDY
EGISGHAEFRGDLRLMCVADINRTNGDLSALDIVPLRAHRFSLVYPSGTDLEWIGETLAR
ESGRFGTIIVQGPAGHLNVR
Download sequence
Identical sequences C3KLK7
gi|227820075|ref|YP_002824046.1|NC_012586 gi|227820075|ref|YP_002824046.1| YP_002824046.1.63916 394.NGR_b18450

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]