SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227823474|ref|YP_002827447.1| from Sinorhizobium fredii NGR234

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227823474|ref|YP_002827447.1|
Domain Number 1 Region: 105-353
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 2.66e-23
Family Purple acid phosphatase-like 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|227823474|ref|YP_002827447.1|
Sequence length 372
Comment hypothetical protein NGR_c29510 [Sinorhizobium fredii NGR234]
Sequence
MNNNAFLVPSRRMFLAGAAGFGLSLVAGNGRAATRPLVDATFLFSNDIHACIVSTEGLAP
NCQQEGKTDANLLRHIAALNALPGQLWPETIDGKPSGLASAGTKIVRPSGLVLGGDITDD
GGGQVREPREGRQLQQFQSRYEHGVGPHHIHYPVYVGLGNHDLDQDGTPPNVDWYRRELR
DYVELTHRQSVFYKPQVPVSNYDPLSDNYSWDWGGLHLVQLQRFGGDRNKGAVSGLPWLK
RDLAAFAADGRPVVLFQHYGWDAFSTEVWDAAAGTFDDQGGGEPHWWSPAERDRLLATLE
GYNVVGLFHGHEHDRVMAYRVGGLDVFKPKAAYLGGFALVRVTDEFLDVVFGEARGETGR
AAFTHAFNRRFG
Download sequence
Identical sequences C3M8Y3
gi|227823474|ref|YP_002827447.1| YP_002827447.1.63916 394.NGR_c29510

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]