SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|227823712|ref|YP_002827685.1| from Sinorhizobium fredii NGR234

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|227823712|ref|YP_002827685.1|
Domain Number 1 Region: 140-513
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 4.55e-34
Family Purple acid phosphatase-like 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|227823712|ref|YP_002827685.1|
Sequence length 519
Comment alkaline phosphatase [Sinorhizobium fredii NGR234]
Sequence
MADIRSTLTRRSFLLSGGAAGLAASSGLATPFYARGYGRPEFLHGVQSGDVDPQSGMIWT
RVDRPARVAVEYSTTESFSTAIRLPDIDVTPQTDCAVKCQLDKLLPDQDIFYRFTATDLY
DANRVSEPIVGRFRTAPLRRRSVRFAWSGDTAGQGWGIDEVGMKTYSTMRLHEPDFFIHS
GDTIYADNPIPDEIKLRDGGMWKNRIVTAEKRDVARTLGEYRGQWKYNLLDEHVRGLNAV
CPTFYQWDDHEVLNNWSASTDLRDDPRYPEKDVTVYAARAARAFHEMTPIRTLPTQPGRI
FRKIAYGPLLDVFFVDLRSYRGPNQGGEAGLFGWRQMDWLKRALAASRATWKVIACDMPI
GLVVWDDYSRKRGSDAIANGDNGAPGGRETEFADLLRFIRDNAIDNIVWLTADVHYTAAH
HYDPSRAAFKDFLPFWEFVSGPLHSGTYGPKELDMTFGPQVRFIKASAGGIDSNLPPSAG
LQFFGIVDINGQTEQLTVRLMDRQDQELWRVTLDPAAVA
Download sequence
Identical sequences C3MAD9
gi|227823712|ref|YP_002827685.1| YP_002827685.1.63916 394.NGR_c31990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]