SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|225856050|ref|YP_002737561.1| from Streptococcus pneumoniae P1031

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|225856050|ref|YP_002737561.1|
Domain Number 1 Region: 121-268
Classification Level Classification E-value
Superfamily 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 2.49e-49
Family 6-hydroxymethyl-7,8-dihydropterin pyrophosphokinase, HPPK 0.00016
Further Details:      
 
Domain Number 2 Region: 2-119
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 4.09e-28
Family DHN aldolase/epimerase 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|225856050|ref|YP_002737561.1|
Sequence length 270
Comment bifunctional folate synthesis protein [Streptococcus pneumoniae P1031]
Sequence
MDQLQIKDLEMFAYHGLFPSEKELGQKFVVSAILSYDMTKAATDLDLTASVHYGELCQQW
TTWFQETSEDLIETVAYKLVERTFESYPLVQEMKLELKKPWAPVHLSLDTCSVTIHRRKQ
RAFIALGSNMGDKQANLKQAIDKLRARGIHILKESSVLATEPWGGVEQDSFANQVVEVET
WLPAQDLLETLLAIESELGRVREVHWGPRLIDLDLLFVEDQILYTDDLILPHPYIAERLF
VLESLQEIAPHFIHPILKQPIRNLYDALKK
Download sequence
Identical sequences A0A0B7M3G7 A5M4R2 M5MZS9
WP_000372531.1.10 WP_000372531.1.100048 WP_000372531.1.10009 WP_000372531.1.100153 WP_000372531.1.100186 WP_000372531.1.100192 WP_000372531.1.100289 WP_000372531.1.100341 WP_000372531.1.100364 WP_000372531.1.100529 WP_000372531.1.100532 WP_000372531.1.100547 WP_000372531.1.100569 WP_000372531.1.100640 WP_000372531.1.100734 WP_000372531.1.100892 WP_000372531.1.100911 WP_000372531.1.100997 WP_000372531.1.101044 WP_000372531.1.101092 WP_000372531.1.101106 WP_000372531.1.101201 WP_000372531.1.10122 WP_000372531.1.101369 WP_000372531.1.101373 WP_000372531.1.101394 WP_000372531.1.101457 WP_000372531.1.101464 WP_000372531.1.101489 WP_000372531.1.101500 WP_000372531.1.101595 WP_000372531.1.10169 WP_000372531.1.101738 WP_000372531.1.101750 WP_000372531.1.101806 WP_000372531.1.101875 WP_000372531.1.101891 WP_000372531.1.101912 WP_000372531.1.101974 WP_000372531.1.102077 WP_000372531.1.102141 WP_000372531.1.1026 WP_000372531.1.10391 WP_000372531.1.10426 WP_000372531.1.10500 WP_000372531.1.10504 WP_000372531.1.10515 WP_000372531.1.10760 WP_000372531.1.10819 WP_000372531.1.10910 WP_000372531.1.10948 WP_000372531.1.11085 WP_000372531.1.11103 WP_000372531.1.11120 WP_000372531.1.11151 WP_000372531.1.11154 WP_000372531.1.11279 WP_000372531.1.11474 WP_000372531.1.11510 WP_000372531.1.11534 WP_000372531.1.11537 WP_000372531.1.11570 WP_000372531.1.11619 WP_000372531.1.11622 WP_000372531.1.11664 WP_000372531.1.11669 WP_000372531.1.11706 WP_000372531.1.11792 WP_000372531.1.11950 WP_000372531.1.12182 WP_000372531.1.12214 WP_000372531.1.12407 WP_000372531.1.12428 WP_000372531.1.12440 WP_000372531.1.12470 WP_000372531.1.12573 WP_000372531.1.1262 WP_000372531.1.12805 WP_000372531.1.12859 WP_000372531.1.12905 WP_000372531.1.12966 WP_000372531.1.13000 WP_000372531.1.1302 WP_000372531.1.13100 WP_000372531.1.13140 WP_000372531.1.13152 WP_000372531.1.13209 WP_000372531.1.13256 WP_000372531.1.13257 WP_000372531.1.1329 WP_000372531.1.1330 WP_000372531.1.13328 WP_000372531.1.13331 WP_000372531.1.13340 WP_000372531.1.13351 WP_000372531.1.13363 WP_000372531.1.13382 WP_000372531.1.13643 WP_000372531.1.13653 WP_000372531.1.13692 WP_000372531.1.13705 WP_000372531.1.1371 WP_000372531.1.13738 WP_000372531.1.139 WP_000372531.1.14033 WP_000372531.1.14060 WP_000372531.1.14106 WP_000372531.1.14218 WP_000372531.1.14258 WP_000372531.1.14291 WP_000372531.1.14295 WP_000372531.1.14335 WP_000372531.1.14350 WP_000372531.1.14435 WP_000372531.1.14541 WP_000372531.1.14682 WP_000372531.1.14722 WP_000372531.1.14757 WP_000372531.1.14784 WP_000372531.1.14826 WP_000372531.1.14949 WP_000372531.1.14983 WP_000372531.1.15018 WP_000372531.1.15045 WP_000372531.1.1522 WP_000372531.1.15266 WP_000372531.1.15391 WP_000372531.1.15425 WP_000372531.1.15639 WP_000372531.1.15670 WP_000372531.1.15720 WP_000372531.1.15841 WP_000372531.1.15872 WP_000372531.1.15900 WP_000372531.1.16081 WP_000372531.1.16099 WP_000372531.1.16118 WP_000372531.1.16145 WP_000372531.1.16316 WP_000372531.1.16479 WP_000372531.1.16570 WP_000372531.1.16676 WP_000372531.1.16727 WP_000372531.1.16849 WP_000372531.1.16886 WP_000372531.1.16889 WP_000372531.1.16902 WP_000372531.1.1698 WP_000372531.1.17003 WP_000372531.1.17029 WP_000372531.1.17133 WP_000372531.1.17257 WP_000372531.1.17269 WP_000372531.1.17315 WP_000372531.1.17426 WP_000372531.1.17474 WP_000372531.1.17609 WP_000372531.1.17706 WP_000372531.1.17776 WP_000372531.1.17895 WP_000372531.1.17972 WP_000372531.1.18012 WP_000372531.1.18018 WP_000372531.1.18131 WP_000372531.1.18236 WP_000372531.1.18266 WP_000372531.1.18415 WP_000372531.1.18423 WP_000372531.1.18464 WP_000372531.1.18514 WP_000372531.1.18571 WP_000372531.1.18572 WP_000372531.1.18630 WP_000372531.1.18644 WP_000372531.1.18670 WP_000372531.1.18768 WP_000372531.1.18771 WP_000372531.1.1887 WP_000372531.1.18884 WP_000372531.1.18948 WP_000372531.1.1899 WP_000372531.1.19003 WP_000372531.1.19172 WP_000372531.1.19201 WP_000372531.1.19239 WP_000372531.1.19359 WP_000372531.1.19368 WP_000372531.1.19489 WP_000372531.1.19510 WP_000372531.1.19513 WP_000372531.1.19633 WP_000372531.1.19721 WP_000372531.1.19754 WP_000372531.1.20139 WP_000372531.1.20185 WP_000372531.1.20382 WP_000372531.1.20470 WP_000372531.1.20491 WP_000372531.1.20702 WP_000372531.1.20711 WP_000372531.1.20712 WP_000372531.1.21175 WP_000372531.1.21271 WP_000372531.1.21394 WP_000372531.1.21421 WP_000372531.1.21422 WP_000372531.1.21426 WP_000372531.1.21551 WP_000372531.1.21599 WP_000372531.1.21605 WP_000372531.1.21620 WP_000372531.1.21642 WP_000372531.1.21685 WP_000372531.1.2173 WP_000372531.1.2180 WP_000372531.1.21824 WP_000372531.1.21848 WP_000372531.1.21885 WP_000372531.1.21979 WP_000372531.1.22057 WP_000372531.1.22083 WP_000372531.1.22131 WP_000372531.1.22196 WP_000372531.1.22297 WP_000372531.1.223 WP_000372531.1.2255 WP_000372531.1.22561 WP_000372531.1.22616 WP_000372531.1.22753 WP_000372531.1.2295 WP_000372531.1.2296 WP_000372531.1.23180 WP_000372531.1.23354 WP_000372531.1.23600 WP_000372531.1.23620 WP_000372531.1.23649 WP_000372531.1.23742 WP_000372531.1.23770 WP_000372531.1.23916 WP_000372531.1.23930 WP_000372531.1.23937 WP_000372531.1.23964 WP_000372531.1.23966 WP_000372531.1.24085 WP_000372531.1.24116 WP_000372531.1.24164 WP_000372531.1.24222 WP_000372531.1.24232 WP_000372531.1.2429 WP_000372531.1.24356 WP_000372531.1.24384 WP_000372531.1.24401 WP_000372531.1.24522 WP_000372531.1.24627 WP_000372531.1.24910 WP_000372531.1.24947 WP_000372531.1.25202 WP_000372531.1.25244 WP_000372531.1.25366 WP_000372531.1.25472 WP_000372531.1.25684 WP_000372531.1.25685 WP_000372531.1.25749 WP_000372531.1.25754 WP_000372531.1.25767 WP_000372531.1.25771 WP_000372531.1.25883 WP_000372531.1.25982 WP_000372531.1.25986 WP_000372531.1.25994 WP_000372531.1.2610 WP_000372531.1.26141 WP_000372531.1.26257 WP_000372531.1.2629 WP_000372531.1.26317 WP_000372531.1.26447 WP_000372531.1.26625 WP_000372531.1.26698 WP_000372531.1.26725 WP_000372531.1.26743 WP_000372531.1.26783 WP_000372531.1.26909 WP_000372531.1.26910 WP_000372531.1.26918 WP_000372531.1.26926 WP_000372531.1.26968 WP_000372531.1.26985 WP_000372531.1.27022 WP_000372531.1.27082 WP_000372531.1.27308 WP_000372531.1.27394 WP_000372531.1.27418 WP_000372531.1.27589 WP_000372531.1.27610 WP_000372531.1.27829 WP_000372531.1.27866 WP_000372531.1.27988 WP_000372531.1.280 WP_000372531.1.28146 WP_000372531.1.28248 WP_000372531.1.28307 WP_000372531.1.28524 WP_000372531.1.28542 WP_000372531.1.2857 WP_000372531.1.28604 WP_000372531.1.28643 WP_000372531.1.2868 WP_000372531.1.28746 WP_000372531.1.28767 WP_000372531.1.28956 WP_000372531.1.28957 WP_000372531.1.29104 WP_000372531.1.29151 WP_000372531.1.29192 WP_000372531.1.2922 WP_000372531.1.29253 WP_000372531.1.29269 WP_000372531.1.29284 WP_000372531.1.29300 WP_000372531.1.29317 WP_000372531.1.29338 WP_000372531.1.29473 WP_000372531.1.29655 WP_000372531.1.29694 WP_000372531.1.29810 WP_000372531.1.29944 WP_000372531.1.29951 WP_000372531.1.30038 WP_000372531.1.30055 WP_000372531.1.30119 WP_000372531.1.30137 WP_000372531.1.30142 WP_000372531.1.30233 WP_000372531.1.30234 WP_000372531.1.30280 WP_000372531.1.30287 WP_000372531.1.30305 WP_000372531.1.30335 WP_000372531.1.30368 WP_000372531.1.30384 WP_000372531.1.30427 WP_000372531.1.30784 WP_000372531.1.30795 WP_000372531.1.30864 WP_000372531.1.30869 WP_000372531.1.30917 WP_000372531.1.30959 WP_000372531.1.30982 WP_000372531.1.31006 WP_000372531.1.3105 WP_000372531.1.3106 WP_000372531.1.31218 WP_000372531.1.31256 WP_000372531.1.31276 WP_000372531.1.31383 WP_000372531.1.31493 WP_000372531.1.31499 WP_000372531.1.31586 WP_000372531.1.31603 WP_000372531.1.31620 WP_000372531.1.31876 WP_000372531.1.31912 WP_000372531.1.31915 WP_000372531.1.31929 WP_000372531.1.31974 WP_000372531.1.31996 WP_000372531.1.32035 WP_000372531.1.32083 WP_000372531.1.32084 WP_000372531.1.32246 WP_000372531.1.32313 WP_000372531.1.32320 WP_000372531.1.32351 WP_000372531.1.32397 WP_000372531.1.32485 WP_000372531.1.32540 WP_000372531.1.32604 WP_000372531.1.32950 WP_000372531.1.33013 WP_000372531.1.33166 WP_000372531.1.3319 WP_000372531.1.33259 WP_000372531.1.33286 WP_000372531.1.33348 WP_000372531.1.33354 WP_000372531.1.33415 WP_000372531.1.33436 WP_000372531.1.33437 WP_000372531.1.33528 WP_000372531.1.33546 WP_000372531.1.3359 WP_000372531.1.33606 WP_000372531.1.33709 WP_000372531.1.33719 WP_000372531.1.33727 WP_000372531.1.33815 WP_000372531.1.33878 WP_000372531.1.33908 WP_000372531.1.3400 WP_000372531.1.34007 WP_000372531.1.34047 WP_000372531.1.34074 WP_000372531.1.34085 WP_000372531.1.34272 WP_000372531.1.34297 WP_000372531.1.34327 WP_000372531.1.34449 WP_000372531.1.3458 WP_000372531.1.34644 WP_000372531.1.34651 WP_000372531.1.34662 WP_000372531.1.34719 WP_000372531.1.34746 WP_000372531.1.34754 WP_000372531.1.34785 WP_000372531.1.3486 WP_000372531.1.34872 WP_000372531.1.34879 WP_000372531.1.34899 WP_000372531.1.35076 WP_000372531.1.35167 WP_000372531.1.35239 WP_000372531.1.35251 WP_000372531.1.35290 WP_000372531.1.35501 WP_000372531.1.35665 WP_000372531.1.35721 WP_000372531.1.35798 WP_000372531.1.3585 WP_000372531.1.35875 WP_000372531.1.3589 WP_000372531.1.35920 WP_000372531.1.35925 WP_000372531.1.36060 WP_000372531.1.3608 WP_000372531.1.3609 WP_000372531.1.36139 WP_000372531.1.36144 WP_000372531.1.36351 WP_000372531.1.36377 WP_000372531.1.36391 WP_000372531.1.36411 WP_000372531.1.3646 WP_000372531.1.36471 WP_000372531.1.36476 WP_000372531.1.36486 WP_000372531.1.36492 WP_000372531.1.36591 WP_000372531.1.36688 WP_000372531.1.367 WP_000372531.1.36715 WP_000372531.1.36731 WP_000372531.1.36732 WP_000372531.1.36772 WP_000372531.1.36795 WP_000372531.1.36867 WP_000372531.1.36963 WP_000372531.1.36994 WP_000372531.1.37068 WP_000372531.1.37107 WP_000372531.1.37243 WP_000372531.1.37301 WP_000372531.1.37324 WP_000372531.1.37357 WP_000372531.1.37488 WP_000372531.1.37508 WP_000372531.1.37658 WP_000372531.1.37684 WP_000372531.1.37883 WP_000372531.1.38014 WP_000372531.1.38029 WP_000372531.1.38073 WP_000372531.1.38093 WP_000372531.1.38378 WP_000372531.1.38459 WP_000372531.1.38527 WP_000372531.1.38560 WP_000372531.1.38573 WP_000372531.1.38588 WP_000372531.1.38602 WP_000372531.1.38708 WP_000372531.1.38860 WP_000372531.1.38918 WP_000372531.1.38934 WP_000372531.1.38955 WP_000372531.1.3899 WP_000372531.1.39083 WP_000372531.1.39125 WP_000372531.1.39339 WP_000372531.1.39412 WP_000372531.1.39431 WP_000372531.1.395 WP_000372531.1.39518 WP_000372531.1.39533 WP_000372531.1.39558 WP_000372531.1.39585 WP_000372531.1.39648 WP_000372531.1.39793 WP_000372531.1.39828 WP_000372531.1.39845 WP_000372531.1.39886 WP_000372531.1.40041 WP_000372531.1.4008 WP_000372531.1.40176 WP_000372531.1.40251 WP_000372531.1.40347 WP_000372531.1.40487 WP_000372531.1.40515 WP_000372531.1.40602 WP_000372531.1.40726 WP_000372531.1.40756 WP_000372531.1.40879 WP_000372531.1.41043 WP_000372531.1.41068 WP_000372531.1.41126 WP_000372531.1.41267 WP_000372531.1.41327 WP_000372531.1.41475 WP_000372531.1.41709 WP_000372531.1.41737 WP_000372531.1.41787 WP_000372531.1.41823 WP_000372531.1.42058 WP_000372531.1.42140 WP_000372531.1.42149 WP_000372531.1.42229 WP_000372531.1.42315 WP_000372531.1.42331 WP_000372531.1.424 WP_000372531.1.42470 WP_000372531.1.4249 WP_000372531.1.42546 WP_000372531.1.42715 WP_000372531.1.42935 WP_000372531.1.42964 WP_000372531.1.42969 WP_000372531.1.43044 WP_000372531.1.43186 WP_000372531.1.43191 WP_000372531.1.43229 WP_000372531.1.43423 WP_000372531.1.43467 WP_000372531.1.43511 WP_000372531.1.43539 WP_000372531.1.4358 WP_000372531.1.43580 WP_000372531.1.4364 WP_000372531.1.43644 WP_000372531.1.43744 WP_000372531.1.43757 WP_000372531.1.43926 WP_000372531.1.44024 WP_000372531.1.44042 WP_000372531.1.44073 WP_000372531.1.44091 WP_000372531.1.44127 WP_000372531.1.44138 WP_000372531.1.44402 WP_000372531.1.44439 WP_000372531.1.44496 WP_000372531.1.44616 WP_000372531.1.4462 WP_000372531.1.44844 WP_000372531.1.44872 WP_000372531.1.44890 WP_000372531.1.44894 WP_000372531.1.451 WP_000372531.1.45112 WP_000372531.1.45118 WP_000372531.1.4512 WP_000372531.1.45220 WP_000372531.1.45276 WP_000372531.1.45287 WP_000372531.1.45325 WP_000372531.1.45417 WP_000372531.1.4547 WP_000372531.1.45481 WP_000372531.1.4559 WP_000372531.1.4566 WP_000372531.1.45762 WP_000372531.1.45917 WP_000372531.1.45959 WP_000372531.1.46022 WP_000372531.1.46155 WP_000372531.1.46252 WP_000372531.1.46296 WP_000372531.1.46480 WP_000372531.1.46483 WP_000372531.1.46498 WP_000372531.1.46564 WP_000372531.1.46649 WP_000372531.1.46784 WP_000372531.1.46884 WP_000372531.1.46901 WP_000372531.1.46927 WP_000372531.1.46955 WP_000372531.1.4707 WP_000372531.1.47168 WP_000372531.1.47213 WP_000372531.1.47365 WP_000372531.1.47452 WP_000372531.1.47483 WP_000372531.1.47596 WP_000372531.1.47633 WP_000372531.1.47651 WP_000372531.1.47657 WP_000372531.1.4768 WP_000372531.1.47699 WP_000372531.1.47771 WP_000372531.1.47781 WP_000372531.1.47785 WP_000372531.1.478 WP_000372531.1.47923 WP_000372531.1.47948 WP_000372531.1.47977 WP_000372531.1.48015 WP_000372531.1.48103 WP_000372531.1.48213 WP_000372531.1.48224 WP_000372531.1.48309 WP_000372531.1.4832 WP_000372531.1.48447 WP_000372531.1.48511 WP_000372531.1.48533 WP_000372531.1.48604 WP_000372531.1.48627 WP_000372531.1.48710 WP_000372531.1.48753 WP_000372531.1.4882 WP_000372531.1.48890 WP_000372531.1.48944 WP_000372531.1.49008 WP_000372531.1.49075 WP_000372531.1.49078 WP_000372531.1.49165 WP_000372531.1.49178 WP_000372531.1.4934 WP_000372531.1.49354 WP_000372531.1.49385 WP_000372531.1.49543 WP_000372531.1.49597 WP_000372531.1.49600 WP_000372531.1.49801 WP_000372531.1.49874 WP_000372531.1.49915 WP_000372531.1.4996 WP_000372531.1.49975 WP_000372531.1.50034 WP_000372531.1.50094 WP_000372531.1.5015 WP_000372531.1.50184 WP_000372531.1.50234 WP_000372531.1.50246 WP_000372531.1.50296 WP_000372531.1.50311 WP_000372531.1.50318 WP_000372531.1.50532 WP_000372531.1.50603 WP_000372531.1.50628 WP_000372531.1.5065 WP_000372531.1.50657 WP_000372531.1.50739 WP_000372531.1.50797 WP_000372531.1.50824 WP_000372531.1.50879 WP_000372531.1.50915 WP_000372531.1.50921 WP_000372531.1.50948 WP_000372531.1.50965 WP_000372531.1.5116 WP_000372531.1.51241 WP_000372531.1.5134 WP_000372531.1.51361 WP_000372531.1.51449 WP_000372531.1.51467 WP_000372531.1.51528 WP_000372531.1.51533 WP_000372531.1.51635 WP_000372531.1.51658 WP_000372531.1.51715 WP_000372531.1.51774 WP_000372531.1.51809 WP_000372531.1.51826 WP_000372531.1.52042 WP_000372531.1.52049 WP_000372531.1.52107 WP_000372531.1.52155 WP_000372531.1.52263 WP_000372531.1.52268 WP_000372531.1.52276 WP_000372531.1.52292 WP_000372531.1.52323 WP_000372531.1.5244 WP_000372531.1.52453 WP_000372531.1.52512 WP_000372531.1.5256 WP_000372531.1.52600 WP_000372531.1.5261 WP_000372531.1.52666 WP_000372531.1.52770 WP_000372531.1.52856 WP_000372531.1.52862 WP_000372531.1.5298 WP_000372531.1.53010 WP_000372531.1.53149 WP_000372531.1.53166 WP_000372531.1.53239 WP_000372531.1.53405 WP_000372531.1.53420 WP_000372531.1.5361 WP_000372531.1.53612 WP_000372531.1.53640 WP_000372531.1.53660 WP_000372531.1.53677 WP_000372531.1.53773 WP_000372531.1.53785 WP_000372531.1.53797 WP_000372531.1.5385 WP_000372531.1.53871 WP_000372531.1.53957 WP_000372531.1.54001 WP_000372531.1.54041 WP_000372531.1.54130 WP_000372531.1.54157 WP_000372531.1.54214 WP_000372531.1.54235 WP_000372531.1.5424 WP_000372531.1.54257 WP_000372531.1.54288 WP_000372531.1.54337 WP_000372531.1.54349 WP_000372531.1.54475 WP_000372531.1.54559 WP_000372531.1.54582 WP_000372531.1.54650 WP_000372531.1.54805 WP_000372531.1.54924 WP_000372531.1.54997 WP_000372531.1.55066 WP_000372531.1.55078 WP_000372531.1.55143 WP_000372531.1.55207 WP_000372531.1.55259 WP_000372531.1.55404 WP_000372531.1.55525 WP_000372531.1.55584 WP_000372531.1.55594 WP_000372531.1.55685 WP_000372531.1.55708 WP_000372531.1.55756 WP_000372531.1.55761 WP_000372531.1.55763 WP_000372531.1.56022 WP_000372531.1.56023 WP_000372531.1.56112 WP_000372531.1.56266 WP_000372531.1.56288 WP_000372531.1.56300 WP_000372531.1.56378 WP_000372531.1.56466 WP_000372531.1.56505 WP_000372531.1.56605 WP_000372531.1.56617 WP_000372531.1.56624 WP_000372531.1.56653 WP_000372531.1.56746 WP_000372531.1.56765 WP_000372531.1.56995 WP_000372531.1.57004 WP_000372531.1.57040 WP_000372531.1.57103 WP_000372531.1.57194 WP_000372531.1.57252 WP_000372531.1.57382 WP_000372531.1.57587 WP_000372531.1.57591 WP_000372531.1.57867 WP_000372531.1.57896 WP_000372531.1.57949 WP_000372531.1.57977 WP_000372531.1.58034 WP_000372531.1.58039 WP_000372531.1.58095 WP_000372531.1.58124 WP_000372531.1.58135 WP_000372531.1.58171 WP_000372531.1.58217 WP_000372531.1.58225 WP_000372531.1.58243 WP_000372531.1.58341 WP_000372531.1.5835 WP_000372531.1.58434 WP_000372531.1.58474 WP_000372531.1.58563 WP_000372531.1.58642 WP_000372531.1.58653 WP_000372531.1.58762 WP_000372531.1.58841 WP_000372531.1.59028 WP_000372531.1.59066 WP_000372531.1.59081 WP_000372531.1.59137 WP_000372531.1.59289 WP_000372531.1.59356 WP_000372531.1.5941 WP_000372531.1.59558 WP_000372531.1.59670 WP_000372531.1.59766 WP_000372531.1.59903 WP_000372531.1.6001 WP_000372531.1.60513 WP_000372531.1.60521 WP_000372531.1.60590 WP_000372531.1.60615 WP_000372531.1.6063 WP_000372531.1.60693 WP_000372531.1.6092 WP_000372531.1.60961 WP_000372531.1.60973 WP_000372531.1.60977 WP_000372531.1.60993 WP_000372531.1.61028 WP_000372531.1.61217 WP_000372531.1.6128 WP_000372531.1.61302 WP_000372531.1.61348 WP_000372531.1.61365 WP_000372531.1.61372 WP_000372531.1.61378 WP_000372531.1.61404 WP_000372531.1.61405 WP_000372531.1.61423 WP_000372531.1.61531 WP_000372531.1.61546 WP_000372531.1.61560 WP_000372531.1.61606 WP_000372531.1.61611 WP_000372531.1.61632 WP_000372531.1.61735 WP_000372531.1.61751 WP_000372531.1.6177 WP_000372531.1.61801 WP_000372531.1.61807 WP_000372531.1.6183 WP_000372531.1.61839 WP_000372531.1.61882 WP_000372531.1.6192 WP_000372531.1.61934 WP_000372531.1.61964 WP_000372531.1.62006 WP_000372531.1.62161 WP_000372531.1.62174 WP_000372531.1.62190 WP_000372531.1.62197 WP_000372531.1.62235 WP_000372531.1.62287 WP_000372531.1.62356 WP_000372531.1.62391 WP_000372531.1.62465 WP_000372531.1.62518 WP_000372531.1.62559 WP_000372531.1.62566 WP_000372531.1.62581 WP_000372531.1.62585 WP_000372531.1.62613 WP_000372531.1.62921 WP_000372531.1.63033 WP_000372531.1.63055 WP_000372531.1.63075 WP_000372531.1.63691 WP_000372531.1.63778 WP_000372531.1.63859 WP_000372531.1.6393 WP_000372531.1.64042 WP_000372531.1.64225 WP_000372531.1.64313 WP_000372531.1.64338 WP_000372531.1.64359 WP_000372531.1.64401 WP_000372531.1.6470 WP_000372531.1.64719 WP_000372531.1.64725 WP_000372531.1.64739 WP_000372531.1.64750 WP_000372531.1.6485 WP_000372531.1.64931 WP_000372531.1.6495 WP_000372531.1.64960 WP_000372531.1.64993 WP_000372531.1.65091 WP_000372531.1.65119 WP_000372531.1.6515 WP_000372531.1.65159 WP_000372531.1.65232 WP_000372531.1.65265 WP_000372531.1.65277 WP_000372531.1.65362 WP_000372531.1.6538 WP_000372531.1.65489 WP_000372531.1.65607 WP_000372531.1.65837 WP_000372531.1.65859 WP_000372531.1.65936 WP_000372531.1.65971 WP_000372531.1.6598 WP_000372531.1.66024 WP_000372531.1.66045 WP_000372531.1.66046 WP_000372531.1.66053 WP_000372531.1.66099 WP_000372531.1.66115 WP_000372531.1.66132 WP_000372531.1.66170 WP_000372531.1.66191 WP_000372531.1.66310 WP_000372531.1.66470 WP_000372531.1.66497 WP_000372531.1.66571 WP_000372531.1.66620 WP_000372531.1.66683 WP_000372531.1.66685 WP_000372531.1.66764 WP_000372531.1.66917 WP_000372531.1.6695 WP_000372531.1.66983 WP_000372531.1.67076 WP_000372531.1.67115 WP_000372531.1.67274 WP_000372531.1.67327 WP_000372531.1.67353 WP_000372531.1.67443 WP_000372531.1.67469 WP_000372531.1.67508 WP_000372531.1.67510 WP_000372531.1.67684 WP_000372531.1.6795 WP_000372531.1.67967 WP_000372531.1.67994 WP_000372531.1.68077 WP_000372531.1.68181 WP_000372531.1.68192 WP_000372531.1.68238 WP_000372531.1.68287 WP_000372531.1.68469 WP_000372531.1.68557 WP_000372531.1.68597 WP_000372531.1.68661 WP_000372531.1.68671 WP_000372531.1.68784 WP_000372531.1.68814 WP_000372531.1.68820 WP_000372531.1.68822 WP_000372531.1.6894 WP_000372531.1.69005 WP_000372531.1.69065 WP_000372531.1.69148 WP_000372531.1.69230 WP_000372531.1.69512 WP_000372531.1.69560 WP_000372531.1.69591 WP_000372531.1.69671 WP_000372531.1.69825 WP_000372531.1.69962 WP_000372531.1.69998 WP_000372531.1.70057 WP_000372531.1.70156 WP_000372531.1.70316 WP_000372531.1.70336 WP_000372531.1.70430 WP_000372531.1.70520 WP_000372531.1.70536 WP_000372531.1.70538 WP_000372531.1.7057 WP_000372531.1.70574 WP_000372531.1.7059 WP_000372531.1.70707 WP_000372531.1.70987 WP_000372531.1.70988 WP_000372531.1.71030 WP_000372531.1.71051 WP_000372531.1.71053 WP_000372531.1.71121 WP_000372531.1.7126 WP_000372531.1.71551 WP_000372531.1.71599 WP_000372531.1.71659 WP_000372531.1.71742 WP_000372531.1.71782 WP_000372531.1.71880 WP_000372531.1.71883 WP_000372531.1.72043 WP_000372531.1.72088 WP_000372531.1.721 WP_000372531.1.72368 WP_000372531.1.72407 WP_000372531.1.72416 WP_000372531.1.72565 WP_000372531.1.72825 WP_000372531.1.72890 WP_000372531.1.7300 WP_000372531.1.73065 WP_000372531.1.73099 WP_000372531.1.7310 WP_000372531.1.73133 WP_000372531.1.73181 WP_000372531.1.73320 WP_000372531.1.73336 WP_000372531.1.73369 WP_000372531.1.73384 WP_000372531.1.73500 WP_000372531.1.7352 WP_000372531.1.73548 WP_000372531.1.73588 WP_000372531.1.73812 WP_000372531.1.73914 WP_000372531.1.73979 WP_000372531.1.74009 WP_000372531.1.74127 WP_000372531.1.74231 WP_000372531.1.74233 WP_000372531.1.74364 WP_000372531.1.74385 WP_000372531.1.74396 WP_000372531.1.74471 WP_000372531.1.74548 WP_000372531.1.74582 WP_000372531.1.74618 WP_000372531.1.7466 WP_000372531.1.74751 WP_000372531.1.74848 WP_000372531.1.7488 WP_000372531.1.7505 WP_000372531.1.75074 WP_000372531.1.75099 WP_000372531.1.75123 WP_000372531.1.75191 WP_000372531.1.75260 WP_000372531.1.75284 WP_000372531.1.75355 WP_000372531.1.75370 WP_000372531.1.75384 WP_000372531.1.75429 WP_000372531.1.75490 WP_000372531.1.75546 WP_000372531.1.75547 WP_000372531.1.75648 WP_000372531.1.75817 WP_000372531.1.75845 WP_000372531.1.75955 WP_000372531.1.76041 WP_000372531.1.76056 WP_000372531.1.76165 WP_000372531.1.76195 WP_000372531.1.76357 WP_000372531.1.76440 WP_000372531.1.76453 WP_000372531.1.76594 WP_000372531.1.76650 WP_000372531.1.76764 WP_000372531.1.76826 WP_000372531.1.76972 WP_000372531.1.77094 WP_000372531.1.77104 WP_000372531.1.77278 WP_000372531.1.77378 WP_000372531.1.77379 WP_000372531.1.77410 WP_000372531.1.77534 WP_000372531.1.77552 WP_000372531.1.77585 WP_000372531.1.77659 WP_000372531.1.77731 WP_000372531.1.77780 WP_000372531.1.77872 WP_000372531.1.77877 WP_000372531.1.77906 WP_000372531.1.78003 WP_000372531.1.7803 WP_000372531.1.78058 WP_000372531.1.78079 WP_000372531.1.78139 WP_000372531.1.78147 WP_000372531.1.78241 WP_000372531.1.78253 WP_000372531.1.78270 WP_000372531.1.78312 WP_000372531.1.78318 WP_000372531.1.78467 WP_000372531.1.78609 WP_000372531.1.78720 WP_000372531.1.78828 WP_000372531.1.78832 WP_000372531.1.78915 WP_000372531.1.78965 WP_000372531.1.78967 WP_000372531.1.78979 WP_000372531.1.79104 WP_000372531.1.79134 WP_000372531.1.7919 WP_000372531.1.79228 WP_000372531.1.79245 WP_000372531.1.79329 WP_000372531.1.79349 WP_000372531.1.79527 WP_000372531.1.7954 WP_000372531.1.79557 WP_000372531.1.79612 WP_000372531.1.79830 WP_000372531.1.79835 WP_000372531.1.800 WP_000372531.1.80070 WP_000372531.1.80251 WP_000372531.1.80268 WP_000372531.1.80373 WP_000372531.1.80435 WP_000372531.1.80495 WP_000372531.1.80501 WP_000372531.1.80597 WP_000372531.1.80691 WP_000372531.1.80774 WP_000372531.1.80856 WP_000372531.1.80875 WP_000372531.1.80914 WP_000372531.1.80949 WP_000372531.1.8109 WP_000372531.1.81090 WP_000372531.1.81360 WP_000372531.1.81398 WP_000372531.1.81573 WP_000372531.1.81586 WP_000372531.1.81677 WP_000372531.1.81716 WP_000372531.1.81801 WP_000372531.1.81890 WP_000372531.1.81894 WP_000372531.1.82033 WP_000372531.1.82042 WP_000372531.1.82052 WP_000372531.1.82181 WP_000372531.1.82191 WP_000372531.1.82306 WP_000372531.1.82407 WP_000372531.1.82425 WP_000372531.1.82437 WP_000372531.1.82680 WP_000372531.1.82693 WP_000372531.1.82702 WP_000372531.1.82750 WP_000372531.1.82827 WP_000372531.1.82840 WP_000372531.1.82918 WP_000372531.1.83123 WP_000372531.1.83168 WP_000372531.1.83174 WP_000372531.1.83281 WP_000372531.1.83311 WP_000372531.1.83324 WP_000372531.1.83457 WP_000372531.1.8347 WP_000372531.1.83577 WP_000372531.1.83587 WP_000372531.1.83636 WP_000372531.1.83916 WP_000372531.1.83963 WP_000372531.1.8398 WP_000372531.1.84038 WP_000372531.1.84061 WP_000372531.1.84211 WP_000372531.1.84304 WP_000372531.1.8438 WP_000372531.1.84382 WP_000372531.1.84505 WP_000372531.1.84542 WP_000372531.1.84785 WP_000372531.1.8481 WP_000372531.1.84827 WP_000372531.1.84842 WP_000372531.1.8486 WP_000372531.1.84979 WP_000372531.1.84991 WP_000372531.1.84998 WP_000372531.1.85093 WP_000372531.1.8510 WP_000372531.1.85195 WP_000372531.1.85212 WP_000372531.1.85215 WP_000372531.1.85222 WP_000372531.1.85418 WP_000372531.1.8547 WP_000372531.1.85581 WP_000372531.1.85629 WP_000372531.1.85652 WP_000372531.1.85748 WP_000372531.1.85826 WP_000372531.1.85896 WP_000372531.1.8590 WP_000372531.1.86020 WP_000372531.1.86112 WP_000372531.1.86237 WP_000372531.1.86403 WP_000372531.1.86689 WP_000372531.1.86723 WP_000372531.1.86742 WP_000372531.1.86746 WP_000372531.1.86918 WP_000372531.1.87065 WP_000372531.1.8708 WP_000372531.1.87186 WP_000372531.1.87332 WP_000372531.1.87422 WP_000372531.1.87575 WP_000372531.1.87604 WP_000372531.1.87664 WP_000372531.1.87699 WP_000372531.1.87771 WP_000372531.1.87872 WP_000372531.1.87904 WP_000372531.1.87961 WP_000372531.1.87993 WP_000372531.1.88129 WP_000372531.1.88218 WP_000372531.1.88280 WP_000372531.1.88519 WP_000372531.1.88523 WP_000372531.1.88662 WP_000372531.1.88811 WP_000372531.1.89016 WP_000372531.1.89032 WP_000372531.1.89369 WP_000372531.1.89565 WP_000372531.1.89620 WP_000372531.1.89652 WP_000372531.1.89654 WP_000372531.1.89684 WP_000372531.1.89702 WP_000372531.1.89843 WP_000372531.1.89905 WP_000372531.1.90059 WP_000372531.1.90071 WP_000372531.1.90202 WP_000372531.1.90234 WP_000372531.1.90281 WP_000372531.1.90495 WP_000372531.1.90678 WP_000372531.1.907 WP_000372531.1.90768 WP_000372531.1.90805 WP_000372531.1.90869 WP_000372531.1.9090 WP_000372531.1.90925 WP_000372531.1.91034 WP_000372531.1.91037 WP_000372531.1.91058 WP_000372531.1.91119 WP_000372531.1.9124 WP_000372531.1.91269 WP_000372531.1.91413 WP_000372531.1.91468 WP_000372531.1.91650 WP_000372531.1.91686 WP_000372531.1.91718 WP_000372531.1.91815 WP_000372531.1.91927 WP_000372531.1.92092 WP_000372531.1.92121 WP_000372531.1.92166 WP_000372531.1.9218 WP_000372531.1.92187 WP_000372531.1.92271 WP_000372531.1.92381 WP_000372531.1.92464 WP_000372531.1.92563 WP_000372531.1.92724 WP_000372531.1.92837 WP_000372531.1.92866 WP_000372531.1.92906 WP_000372531.1.92967 WP_000372531.1.92971 WP_000372531.1.93129 WP_000372531.1.93158 WP_000372531.1.93210 WP_000372531.1.93238 WP_000372531.1.93274 WP_000372531.1.93281 WP_000372531.1.93398 WP_000372531.1.93474 WP_000372531.1.93515 WP_000372531.1.93592 WP_000372531.1.93786 WP_000372531.1.93811 WP_000372531.1.93902 WP_000372531.1.93974 WP_000372531.1.94068 WP_000372531.1.94148 WP_000372531.1.94323 WP_000372531.1.94357 WP_000372531.1.94442 WP_000372531.1.94444 WP_000372531.1.94476 WP_000372531.1.94503 WP_000372531.1.94526 WP_000372531.1.94538 WP_000372531.1.94643 WP_000372531.1.94651 WP_000372531.1.94689 WP_000372531.1.94883 WP_000372531.1.95058 WP_000372531.1.95276 WP_000372531.1.95322 WP_000372531.1.95334 WP_000372531.1.95468 WP_000372531.1.95553 WP_000372531.1.95722 WP_000372531.1.95736 WP_000372531.1.95740 WP_000372531.1.95807 WP_000372531.1.95822 WP_000372531.1.95879 WP_000372531.1.95881 WP_000372531.1.95933 WP_000372531.1.96016 WP_000372531.1.96049 WP_000372531.1.96100 WP_000372531.1.96111 WP_000372531.1.96189 WP_000372531.1.96244 WP_000372531.1.96277 WP_000372531.1.96432 WP_000372531.1.96448 WP_000372531.1.96728 WP_000372531.1.9681 WP_000372531.1.96819 WP_000372531.1.96821 WP_000372531.1.96858 WP_000372531.1.96901 WP_000372531.1.96958 WP_000372531.1.96961 WP_000372531.1.96974 WP_000372531.1.97066 WP_000372531.1.97073 WP_000372531.1.971 WP_000372531.1.97162 WP_000372531.1.97187 WP_000372531.1.97254 WP_000372531.1.97278 WP_000372531.1.97526 WP_000372531.1.97570 WP_000372531.1.97686 WP_000372531.1.97738 WP_000372531.1.97829 WP_000372531.1.97831 WP_000372531.1.97878 WP_000372531.1.98057 WP_000372531.1.98103 WP_000372531.1.9819 WP_000372531.1.98245 WP_000372531.1.98461 WP_000372531.1.98732 WP_000372531.1.98740 WP_000372531.1.98781 WP_000372531.1.98787 WP_000372531.1.98862 WP_000372531.1.98989 WP_000372531.1.99001 WP_000372531.1.99114 WP_000372531.1.99138 WP_000372531.1.99148 WP_000372531.1.9915 WP_000372531.1.99291 WP_000372531.1.99362 WP_000372531.1.99436 WP_000372531.1.99451 WP_000372531.1.99502 WP_000372531.1.99611 WP_000372531.1.99623 WP_000372531.1.99624 WP_000372531.1.99678 WP_000372531.1.99687 WP_000372531.1.99781 WP_000372531.1.99879 WP_000372531.1.99900 gi|225856050|ref|YP_002737561.1| gi|194398210|ref|YP_002036992.1| 488223.SPP_0342 512566.SPG_0277 gi|307066968|ref|YP_003875934.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]