SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|222152106|ref|YP_002561266.1| from Macrococcus caseolyticus JCSC5402

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|222152106|ref|YP_002561266.1|
Domain Number 1 Region: 1-149
Classification Level Classification E-value
Superfamily Ribosomal protein S7 2.75e-60
Family Ribosomal protein S7 0.000000487
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|222152106|ref|YP_002561266.1|
Sequence length 156
Comment 30S ribosomal protein S7 [Macrococcus caseolyticus JCSC5402]
Sequence
MPRKGPVAKRDVLPDPIHNSKLVTKLINKIMIDGKRGTAQKILYNAFDLVQERSGRDAME
VFEEAINNIMPVLEVKARRVGGSNYQVPVEVRAERRTTLGLRWLVNYSRLRGEKTMEERL
ANEILDAANNTGGAVKKREDTHKMAEANKAFAHYRW
Download sequence
Identical sequences A0A1W7A8W9 A0A1W7AEH3 A0A2G5P2N9 B9E8Q2
WP_015912362.1.50991 WP_015912362.1.68376 WP_015912362.1.84794 gi|222152106|ref|YP_002561266.1| 458233.MCCL_1863

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]