SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|253995427|ref|YP_003047491.1| from Methylotenera mobilis JLW8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|253995427|ref|YP_003047491.1|
Domain Number 1 Region: 132-286
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 1.19e-38
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.0055
Further Details:      
 
Domain Number 2 Region: 61-117
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000896
Family AraC type transcriptional activator 0.0033
Further Details:      
 
Domain Number 3 Region: 9-59
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000166
Family AraC type transcriptional activator 0.0084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|253995427|ref|YP_003047491.1|
Sequence length 286
Comment AraC family transcriptional regulator [Methylotenera mobilis JLW8]
Sequence
MSKASAYETRFNRVFDYIDKHLGEVLTLESVSQVASFSKYHFHRQFSEYTGISVFRYIQL
MRLKRASYRLAFNKIEMITDIALDAGFENPESFSRAFKNAFGQTPSGFRRSPAWEPWNER
YQLPNRERKQSMEVNIIEFEETKVAVLEHRGTPALINDSVGIFIEWRKSSGLSPVKSSES
FGIAYDNPDTTDPEQFRFDICGSVSEDVPDNPQGVVNKIIPRGRCAVIRHHGSHDRIGTC
AYYLYRDWLPESGEELRDFPLYFHYLNLLPDTSEHELITDIYLPLK
Download sequence
Identical sequences C6WY68
583345.Mmol_0053 WP_012777421.1.100669 gi|253995427|ref|YP_003047491.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]