SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|254778926|ref|YP_003057031.1| from Helicobacter pylori B38

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|254778926|ref|YP_003057031.1|
Domain Number 1 Region: 10-177
Classification Level Classification E-value
Superfamily PEBP-like 1.83e-31
Family Prokaryotic PEBP-like proteins 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|254778926|ref|YP_003057031.1|
Sequence length 183
Comment hypothetical protein HELPY_0222 [Helicobacter pylori B38]
Sequence
MKTFEVMIQTDSEGYLDAKFGGNAPRGFLNPNGLPTYSPKISWQKVEGAQSYALELIDHD
AQKVCGMSFIHWVVGNISHNVLEENASMMDKRITQGVNSLTQGFIRSPLNESEKQRSNLN
NSVYIGPMPPNGDHHYLIQVYALDIPKLALKAPFFLGDLHDKMRNHIIAIGRKEFLYKQF
VRK
Download sequence
Identical sequences C7BY56
WP_000846513.1.98582 592205.HELPY_0222 gi|254778926|ref|YP_003057031.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]