SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256015708|ref|YP_003105717.1| from Brucella microti CCM 4915

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256015708|ref|YP_003105717.1|
Domain Number 1 Region: 8-317
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 5.63e-68
Family beta-Lactamase/D-ala carboxypeptidase 0.000000000113
Further Details:      
 
Domain Number 2 Region: 420-517
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 8.11e-42
Family D-aminopeptidase, middle and C-terminal domains 0.00000318
Further Details:      
 
Domain Number 3 Region: 336-417
Classification Level Classification E-value
Superfamily D-aminopeptidase, middle and C-terminal domains 2.88e-38
Family D-aminopeptidase, middle and C-terminal domains 0.0000496
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256015708|ref|YP_003105717.1|
Sequence length 518
Comment D-aminopeptidase [Brucella microti CCM 4915]
Sequence
MPNIDLPTLEAFVHAIPQNYKGPGGAVAVVRNGEIVLRHAWGFADLAARKAMTPETRMPI
CSVSKQFTCAVLLDCIGEPEMLDSALAAYLDQFEDGRPAVRDLCNNQSGLRDYWALTVLC
GAAPEGIFLPDQAQNLLRRLKTTHFAPGTHYSYCNGNFRILADLIEQHTGRSLADLLAER
IFAPAAMKTAELIPDTALFNECTGYEGDTVRGFLPAINRIHWLGDAGICASLDDMIAWEQ
FIDRTRHDENGLYRRLSSPQTFADGAPAPYGFGLKFEETGGKRLTGHGGALRGWRCQRWH
CADERISTIVMFNFEGNASDAALKMMNAALGIPPAKPVRAQANPGWFGSWLNPETGLVLS
LEDAGGGRMKARFGTGPEIMDISGENEAQSSMTTLRRDGDMIHLARKDENLHLAMHRLKG
EARQDIAGRYRSDELEADLLLVSEGGAIYGAFEGFLGKSDMYPLYAAGPDVWLLPVQRSM
DAPSPGEWKLVFHRDAAGRITGVTVGCWLARGVEYKRL
Download sequence
Identical sequences A0A0E1WV65 A0A0M1WGJ3 A0A2D2BUL0 A0A2K4NNR8 A9MCM7 A9WVV8 B2SD81 C4IUS4 C7LJ67 D7H699 Q2YLB4 Q579G4 Q8FV99
gi|23500673|ref|NP_700113.1| gi|189022490|ref|YP_001932231.1| gi|376278894|ref|YP_005108927.1| 204722.BRA0947 262698.BruAb2_0286 359391.BAB2_0287 430066.BAbS19_II02740 470137.BSUIS_B0939 483179.BCAN_B0968 568815.BMI_II941 gi|340792717|ref|YP_004758181.1| gi|376270840|ref|YP_005113885.1| gi|161620999|ref|YP_001594885.1| gi|83269209|ref|YP_418500.1| gi|62317228|ref|YP_223081.1| WP_002965700.1.100018 WP_002965700.1.100204 WP_002965700.1.100443 WP_002965700.1.101247 WP_002965700.1.102082 WP_002965700.1.10307 WP_002965700.1.10322 WP_002965700.1.10630 WP_002965700.1.10893 WP_002965700.1.1158 WP_002965700.1.11620 WP_002965700.1.11769 WP_002965700.1.12041 WP_002965700.1.12241 WP_002965700.1.13020 WP_002965700.1.13460 WP_002965700.1.13576 WP_002965700.1.13592 WP_002965700.1.13826 WP_002965700.1.14542 WP_002965700.1.14633 WP_002965700.1.15077 WP_002965700.1.15325 WP_002965700.1.16733 WP_002965700.1.16975 WP_002965700.1.17378 WP_002965700.1.17733 WP_002965700.1.1800 WP_002965700.1.18034 WP_002965700.1.18635 WP_002965700.1.19508 WP_002965700.1.19641 WP_002965700.1.19645 WP_002965700.1.20012 WP_002965700.1.20317 WP_002965700.1.2214 WP_002965700.1.22340 WP_002965700.1.22583 WP_002965700.1.2337 WP_002965700.1.23458 WP_002965700.1.24196 WP_002965700.1.24428 WP_002965700.1.24496 WP_002965700.1.24655 WP_002965700.1.24726 WP_002965700.1.2483 WP_002965700.1.25101 WP_002965700.1.25382 WP_002965700.1.25561 WP_002965700.1.25729 WP_002965700.1.26599 WP_002965700.1.27052 WP_002965700.1.2778 WP_002965700.1.2839 WP_002965700.1.2874 WP_002965700.1.2877 WP_002965700.1.28889 WP_002965700.1.31106 WP_002965700.1.31239 WP_002965700.1.31463 WP_002965700.1.32337 WP_002965700.1.32492 WP_002965700.1.32731 WP_002965700.1.33220 WP_002965700.1.33599 WP_002965700.1.33753 WP_002965700.1.3390 WP_002965700.1.34225 WP_002965700.1.34353 WP_002965700.1.35056 WP_002965700.1.35970 WP_002965700.1.37797 WP_002965700.1.38343 WP_002965700.1.38353 WP_002965700.1.38790 WP_002965700.1.38925 WP_002965700.1.39021 WP_002965700.1.39039 WP_002965700.1.39963 WP_002965700.1.40138 WP_002965700.1.40407 WP_002965700.1.40624 WP_002965700.1.40649 WP_002965700.1.408 WP_002965700.1.40871 WP_002965700.1.41044 WP_002965700.1.41311 WP_002965700.1.41835 WP_002965700.1.41941 WP_002965700.1.42103 WP_002965700.1.42427 WP_002965700.1.43006 WP_002965700.1.43583 WP_002965700.1.43597 WP_002965700.1.43689 WP_002965700.1.43928 WP_002965700.1.4428 WP_002965700.1.44793 WP_002965700.1.44949 WP_002965700.1.44989 WP_002965700.1.45546 WP_002965700.1.45559 WP_002965700.1.46182 WP_002965700.1.46432 WP_002965700.1.4727 WP_002965700.1.47558 WP_002965700.1.47610 WP_002965700.1.4847 WP_002965700.1.49427 WP_002965700.1.49542 WP_002965700.1.49640 WP_002965700.1.49753 WP_002965700.1.50051 WP_002965700.1.50053 WP_002965700.1.50282 WP_002965700.1.5052 WP_002965700.1.52027 WP_002965700.1.5236 WP_002965700.1.53128 WP_002965700.1.53481 WP_002965700.1.5394 WP_002965700.1.54440 WP_002965700.1.54776 WP_002965700.1.54779 WP_002965700.1.55440 WP_002965700.1.55684 WP_002965700.1.56313 WP_002965700.1.56334 WP_002965700.1.56683 WP_002965700.1.56952 WP_002965700.1.57564 WP_002965700.1.57925 WP_002965700.1.58260 WP_002965700.1.58525 WP_002965700.1.58539 WP_002965700.1.58868 WP_002965700.1.59086 WP_002965700.1.59091 WP_002965700.1.59515 WP_002965700.1.5971 WP_002965700.1.60631 WP_002965700.1.61325 WP_002965700.1.61536 WP_002965700.1.61811 WP_002965700.1.61997 WP_002965700.1.62592 WP_002965700.1.62872 WP_002965700.1.63730 WP_002965700.1.63732 WP_002965700.1.64013 WP_002965700.1.64124 WP_002965700.1.64849 WP_002965700.1.64853 WP_002965700.1.64905 WP_002965700.1.65131 WP_002965700.1.65299 WP_002965700.1.65454 WP_002965700.1.6555 WP_002965700.1.65625 WP_002965700.1.65651 WP_002965700.1.66260 WP_002965700.1.66340 WP_002965700.1.66810 WP_002965700.1.67402 WP_002965700.1.67893 WP_002965700.1.67996 WP_002965700.1.67997 WP_002965700.1.68488 WP_002965700.1.68913 WP_002965700.1.69829 WP_002965700.1.70296 WP_002965700.1.70322 WP_002965700.1.71002 WP_002965700.1.71194 WP_002965700.1.71689 WP_002965700.1.71846 WP_002965700.1.7206 WP_002965700.1.72533 WP_002965700.1.72916 WP_002965700.1.74005 WP_002965700.1.75434 WP_002965700.1.75458 WP_002965700.1.75766 WP_002965700.1.76350 WP_002965700.1.76433 WP_002965700.1.77165 WP_002965700.1.77321 WP_002965700.1.77683 WP_002965700.1.77899 WP_002965700.1.78109 WP_002965700.1.78716 WP_002965700.1.78821 WP_002965700.1.7984 WP_002965700.1.79963 WP_002965700.1.80266 WP_002965700.1.80365 WP_002965700.1.80476 WP_002965700.1.80697 WP_002965700.1.81027 WP_002965700.1.81617 WP_002965700.1.81822 WP_002965700.1.82113 WP_002965700.1.8223 WP_002965700.1.8224 WP_002965700.1.8278 WP_002965700.1.8307 WP_002965700.1.84512 WP_002965700.1.85322 WP_002965700.1.85721 WP_002965700.1.85769 WP_002965700.1.8657 WP_002965700.1.86923 WP_002965700.1.87522 WP_002965700.1.87603 WP_002965700.1.87867 WP_002965700.1.8788 WP_002965700.1.87893 WP_002965700.1.88404 WP_002965700.1.8878 WP_002965700.1.90420 WP_002965700.1.90689 WP_002965700.1.91123 WP_002965700.1.91338 WP_002965700.1.91710 WP_002965700.1.91958 WP_002965700.1.92518 WP_002965700.1.93230 WP_002965700.1.93367 WP_002965700.1.93454 WP_002965700.1.93795 WP_002965700.1.94126 WP_002965700.1.94555 WP_002965700.1.94770 WP_002965700.1.94775 WP_002965700.1.97511 WP_002965700.1.97741 WP_002965700.1.98076 WP_002965700.1.98362 WP_002965700.1.98455 WP_002965700.1.98704 WP_002965700.1.99221 WP_002965700.1.99373 WP_002965700.1.99421 gi|23500673|ref|NP_700113.1| gi|256015708|ref|YP_003105717.1| gi|376277544|ref|YP_005153605.1| gi|163845061|ref|YP_001622716.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]