SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256369669|ref|YP_003107179.1| from Brucella microti CCM 4915

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256369669|ref|YP_003107179.1|
Domain Number 1 Region: 6-226
Classification Level Classification E-value
Superfamily Ribosomal protein L1 4.58e-84
Family Ribosomal protein L1 0.000000734
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256369669|ref|YP_003107179.1|
Sequence length 233
Comment 50S ribosomal protein L1 [Brucella microti CCM 4915]
Sequence
MAKISKRINKIREGVDRNKLYDLSAAIGLVKERAVAKFDETVEIAMNLGVDPRHADQMVR
GVVNLPNGTGRTVRVAVFARGDKAEEAKKAGADIVGAEELFEIVNGGKIEFDRCIATPDM
MPLVGRLGKVLGPRGMMPNPKVGTVTTDVAAAVAASKGGAVEFRVEKAGIIHAGIGKVSF
DNAKLEENIKAFADAVIKAKPSAAKGEYVKRVSISSTMGVGVKVDPSTVKVVD
Download sequence
Identical sequences A0A0E1X2T4 A0A0M1WBG9 A0A0U5IDQ4 A0A1G4EW93 A0A1M4LBB8 A0A1P8S5P6 A0A1Z1ZLY5 A0A2D2BPR0 A0A2K4NKG1 A5VR18 A9M5R3 B2S690 C0G6Y1 C0RJL4 C4IRU7 C7LCJ5 C9VB45 D0RJF1 D1CYK1 D6LKT7 D7GYZ2 E2PJ96 N8LXD4 Q2YM12 Q57CP5 Q8G066
204722.BR1247 262698.BruAb1_1251 359391.BAB1_1267 430066.BAbS19_I11820 444178.BOV_1208 483179.BCAN_A1269 546272.BMEA_A1291 568815.BMI_I1256 gi|376276142|ref|YP_005116581.1| gi|225852743|ref|YP_002732976.1| gi|384211613|ref|YP_005600695.1| gi|62290157|ref|YP_221950.1| gi|148560524|ref|YP_001259165.1| gi|376280918|ref|YP_005154924.1| gi|376273024|ref|YP_005151602.1| gi|560146953|ref|YP_008839769.1| gi|256369669|ref|YP_003107179.1| gi|189024393|ref|YP_001935161.1| gi|384408721|ref|YP_005597342.1| gi|161619202|ref|YP_001593089.1| gi|384445298|ref|YP_005604017.1| gi|23502124|ref|NP_698251.1| WP_002964373.1.100018 WP_002964373.1.100443 WP_002964373.1.100628 WP_002964373.1.100807 WP_002964373.1.101150 WP_002964373.1.101411 WP_002964373.1.101965 WP_002964373.1.102026 WP_002964373.1.102082 WP_002964373.1.10307 WP_002964373.1.10322 WP_002964373.1.1055 WP_002964373.1.10630 WP_002964373.1.10844 WP_002964373.1.10866 WP_002964373.1.10893 WP_002964373.1.11066 WP_002964373.1.11306 WP_002964373.1.11620 WP_002964373.1.11859 WP_002964373.1.11933 WP_002964373.1.12041 WP_002964373.1.12241 WP_002964373.1.12704 WP_002964373.1.12981 WP_002964373.1.13020 WP_002964373.1.13460 WP_002964373.1.13592 WP_002964373.1.13826 WP_002964373.1.14507 WP_002964373.1.14542 WP_002964373.1.14633 WP_002964373.1.15077 WP_002964373.1.15325 WP_002964373.1.15805 WP_002964373.1.16733 WP_002964373.1.16975 WP_002964373.1.17378 WP_002964373.1.1800 WP_002964373.1.18034 WP_002964373.1.18494 WP_002964373.1.18635 WP_002964373.1.19483 WP_002964373.1.19508 WP_002964373.1.19641 WP_002964373.1.19645 WP_002964373.1.20012 WP_002964373.1.20317 WP_002964373.1.20827 WP_002964373.1.21149 WP_002964373.1.22142 WP_002964373.1.22340 WP_002964373.1.22583 WP_002964373.1.2337 WP_002964373.1.24196 WP_002964373.1.24428 WP_002964373.1.24607 WP_002964373.1.24655 WP_002964373.1.24726 WP_002964373.1.2483 WP_002964373.1.24895 WP_002964373.1.24923 WP_002964373.1.24971 WP_002964373.1.25101 WP_002964373.1.25135 WP_002964373.1.25382 WP_002964373.1.25450 WP_002964373.1.25561 WP_002964373.1.25729 WP_002964373.1.26599 WP_002964373.1.27052 WP_002964373.1.27564 WP_002964373.1.2778 WP_002964373.1.27794 WP_002964373.1.2839 WP_002964373.1.2874 WP_002964373.1.2877 WP_002964373.1.28889 WP_002964373.1.29336 WP_002964373.1.29765 WP_002964373.1.29997 WP_002964373.1.31094 WP_002964373.1.31106 WP_002964373.1.31239 WP_002964373.1.31463 WP_002964373.1.31635 WP_002964373.1.31644 WP_002964373.1.31680 WP_002964373.1.32337 WP_002964373.1.32492 WP_002964373.1.32731 WP_002964373.1.32779 WP_002964373.1.33032 WP_002964373.1.33220 WP_002964373.1.33289 WP_002964373.1.33599 WP_002964373.1.33753 WP_002964373.1.3390 WP_002964373.1.33907 WP_002964373.1.34183 WP_002964373.1.34225 WP_002964373.1.34353 WP_002964373.1.34423 WP_002964373.1.35056 WP_002964373.1.35338 WP_002964373.1.35577 WP_002964373.1.35970 WP_002964373.1.36149 WP_002964373.1.36712 WP_002964373.1.3681 WP_002964373.1.37797 WP_002964373.1.38343 WP_002964373.1.38353 WP_002964373.1.38790 WP_002964373.1.38925 WP_002964373.1.39021 WP_002964373.1.39039 WP_002964373.1.39963 WP_002964373.1.40138 WP_002964373.1.40189 WP_002964373.1.40407 WP_002964373.1.40624 WP_002964373.1.40649 WP_002964373.1.408 WP_002964373.1.40871 WP_002964373.1.4091 WP_002964373.1.41044 WP_002964373.1.41105 WP_002964373.1.41311 WP_002964373.1.41344 WP_002964373.1.41835 WP_002964373.1.41893 WP_002964373.1.41941 WP_002964373.1.41950 WP_002964373.1.42065 WP_002964373.1.4207 WP_002964373.1.42071 WP_002964373.1.42103 WP_002964373.1.42427 WP_002964373.1.42633 WP_002964373.1.42774 WP_002964373.1.4295 WP_002964373.1.43006 WP_002964373.1.43058 WP_002964373.1.43148 WP_002964373.1.4319 WP_002964373.1.43359 WP_002964373.1.43583 WP_002964373.1.43597 WP_002964373.1.43689 WP_002964373.1.43928 WP_002964373.1.44045 WP_002964373.1.44060 WP_002964373.1.4428 WP_002964373.1.44294 WP_002964373.1.44541 WP_002964373.1.44793 WP_002964373.1.44989 WP_002964373.1.45559 WP_002964373.1.46182 WP_002964373.1.46432 WP_002964373.1.4727 WP_002964373.1.47545 WP_002964373.1.47558 WP_002964373.1.47610 WP_002964373.1.47843 WP_002964373.1.48075 WP_002964373.1.48184 WP_002964373.1.4847 WP_002964373.1.48727 WP_002964373.1.48744 WP_002964373.1.48948 WP_002964373.1.49542 WP_002964373.1.49640 WP_002964373.1.49753 WP_002964373.1.49942 WP_002964373.1.49953 WP_002964373.1.50051 WP_002964373.1.50053 WP_002964373.1.50282 WP_002964373.1.5052 WP_002964373.1.50952 WP_002964373.1.51553 WP_002964373.1.52027 WP_002964373.1.5236 WP_002964373.1.52478 WP_002964373.1.52541 WP_002964373.1.5307 WP_002964373.1.53128 WP_002964373.1.53481 WP_002964373.1.53843 WP_002964373.1.5394 WP_002964373.1.54440 WP_002964373.1.54481 WP_002964373.1.54776 WP_002964373.1.54779 WP_002964373.1.55047 WP_002964373.1.55284 WP_002964373.1.55440 WP_002964373.1.55585 WP_002964373.1.55684 WP_002964373.1.56313 WP_002964373.1.56334 WP_002964373.1.56621 WP_002964373.1.56683 WP_002964373.1.56947 WP_002964373.1.56952 WP_002964373.1.57541 WP_002964373.1.57564 WP_002964373.1.57925 WP_002964373.1.58260 WP_002964373.1.58525 WP_002964373.1.58539 WP_002964373.1.58868 WP_002964373.1.59086 WP_002964373.1.59091 WP_002964373.1.59515 WP_002964373.1.5971 WP_002964373.1.59985 WP_002964373.1.60134 WP_002964373.1.60631 WP_002964373.1.60920 WP_002964373.1.61081 WP_002964373.1.61325 WP_002964373.1.61536 WP_002964373.1.61543 WP_002964373.1.61811 WP_002964373.1.61961 WP_002964373.1.61997 WP_002964373.1.62592 WP_002964373.1.63628 WP_002964373.1.63730 WP_002964373.1.63732 WP_002964373.1.64013 WP_002964373.1.64124 WP_002964373.1.6440 WP_002964373.1.64585 WP_002964373.1.64849 WP_002964373.1.64853 WP_002964373.1.64883 WP_002964373.1.64905 WP_002964373.1.65131 WP_002964373.1.65199 WP_002964373.1.65299 WP_002964373.1.65454 WP_002964373.1.65501 WP_002964373.1.6555 WP_002964373.1.65597 WP_002964373.1.65625 WP_002964373.1.65651 WP_002964373.1.66078 WP_002964373.1.66260 WP_002964373.1.66268 WP_002964373.1.66407 WP_002964373.1.66647 WP_002964373.1.66810 WP_002964373.1.66855 WP_002964373.1.67107 WP_002964373.1.67659 WP_002964373.1.67893 WP_002964373.1.67996 WP_002964373.1.67997 WP_002964373.1.68488 WP_002964373.1.68913 WP_002964373.1.69451 WP_002964373.1.69829 WP_002964373.1.69997 WP_002964373.1.70160 WP_002964373.1.70296 WP_002964373.1.70322 WP_002964373.1.70570 WP_002964373.1.71002 WP_002964373.1.71077 WP_002964373.1.71194 WP_002964373.1.71228 WP_002964373.1.71689 WP_002964373.1.71846 WP_002964373.1.72012 WP_002964373.1.7206 WP_002964373.1.72189 WP_002964373.1.72439 WP_002964373.1.72916 WP_002964373.1.73628 WP_002964373.1.73739 WP_002964373.1.7388 WP_002964373.1.7410 WP_002964373.1.74236 WP_002964373.1.75128 WP_002964373.1.75434 WP_002964373.1.75458 WP_002964373.1.75563 WP_002964373.1.75766 WP_002964373.1.76350 WP_002964373.1.76433 WP_002964373.1.7667 WP_002964373.1.76877 WP_002964373.1.77281 WP_002964373.1.77321 WP_002964373.1.77685 WP_002964373.1.77899 WP_002964373.1.78109 WP_002964373.1.78225 WP_002964373.1.78590 WP_002964373.1.78716 WP_002964373.1.78821 WP_002964373.1.79327 WP_002964373.1.7984 WP_002964373.1.79963 WP_002964373.1.80059 WP_002964373.1.8012 WP_002964373.1.80167 WP_002964373.1.80266 WP_002964373.1.80365 WP_002964373.1.80476 WP_002964373.1.80697 WP_002964373.1.81276 WP_002964373.1.81377 WP_002964373.1.81558 WP_002964373.1.81617 WP_002964373.1.81674 WP_002964373.1.81822 WP_002964373.1.82113 WP_002964373.1.82205 WP_002964373.1.8223 WP_002964373.1.8224 WP_002964373.1.82390 WP_002964373.1.82448 WP_002964373.1.82565 WP_002964373.1.82595 WP_002964373.1.82753 WP_002964373.1.8278 WP_002964373.1.82834 WP_002964373.1.82990 WP_002964373.1.8307 WP_002964373.1.83513 WP_002964373.1.84207 WP_002964373.1.84540 WP_002964373.1.84601 WP_002964373.1.84764 WP_002964373.1.85322 WP_002964373.1.85684 WP_002964373.1.85721 WP_002964373.1.85753 WP_002964373.1.85769 WP_002964373.1.8657 WP_002964373.1.86832 WP_002964373.1.86901 WP_002964373.1.87222 WP_002964373.1.87269 WP_002964373.1.87522 WP_002964373.1.87603 WP_002964373.1.87867 WP_002964373.1.8788 WP_002964373.1.88404 WP_002964373.1.88424 WP_002964373.1.88658 WP_002964373.1.8878 WP_002964373.1.88867 WP_002964373.1.89113 WP_002964373.1.90027 WP_002964373.1.90689 WP_002964373.1.9096 WP_002964373.1.91081 WP_002964373.1.91123 WP_002964373.1.91338 WP_002964373.1.9163 WP_002964373.1.91710 WP_002964373.1.91768 WP_002964373.1.91958 WP_002964373.1.92383 WP_002964373.1.92518 WP_002964373.1.9303 WP_002964373.1.93230 WP_002964373.1.93367 WP_002964373.1.93454 WP_002964373.1.93795 WP_002964373.1.94126 WP_002964373.1.94513 WP_002964373.1.94555 WP_002964373.1.94648 WP_002964373.1.94775 WP_002964373.1.94843 WP_002964373.1.95141 WP_002964373.1.95148 WP_002964373.1.95178 WP_002964373.1.95770 WP_002964373.1.96661 WP_002964373.1.97240 WP_002964373.1.97320 WP_002964373.1.97331 WP_002964373.1.97511 WP_002964373.1.97741 WP_002964373.1.97860 WP_002964373.1.98076 WP_002964373.1.98362 WP_002964373.1.98455 WP_002964373.1.98764 WP_002964373.1.99221 WP_002964373.1.99373 WP_002964373.1.99421 gi|340790863|ref|YP_004756328.1| gi|23502124|ref|NP_698251.1| gi|82700079|ref|YP_414653.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]