SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256374842|ref|YP_003098502.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256374842|ref|YP_003098502.1|
Domain Number 1 Region: 121-194
Classification Level Classification E-value
Superfamily Probable bacterial effector-binding domain 0.000000000602
Family Gyrase inhibitory protein GyrI (SbmC, YeeB) 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256374842|ref|YP_003098502.1|
Sequence length 207
Comment hypothetical protein Amir_0693 [Actinosynnema mirum DSM 43827]
Sequence
MADKVDFKRTVPSYTAKRDVPELVEVPDLRYLAVDGAGDPNTDAYADAVSALYPVAYRLK
FTSKGDLGRDYVVPPLEGLWWAEDHASFTSGRDKSKWSWTLLLLLPDWVGDDLLAGALDR
VEAGGDPPARLRDVRVEALSEGLCVQALHVGAYDDEAELLRRVHEEFIPEHGLAPTGRHH
EVYLSDPRRTAPAKRRTIVRQPVARLG
Download sequence
Identical sequences C6WKQ1
gi|256374842|ref|YP_003098502.1| 446462.Amir_0693 WP_012783318.1.52053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]