SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256374868|ref|YP_003098528.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256374868|ref|YP_003098528.1|
Domain Number 1 Region: 185-378
Classification Level Classification E-value
Superfamily DNA ligase/mRNA capping enzyme, catalytic domain 1.13e-45
Family ATP-dependent DNA ligase catalytic domain 0.00069
Further Details:      
 
Domain Number 2 Region: 380-504
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.29e-30
Family DNA ligase/mRNA capping enzyme postcatalytic domain 0.002
Further Details:      
 
Domain Number 3 Region: 2-204
Classification Level Classification E-value
Superfamily ATP-dependent DNA ligase DNA-binding domain 6.41e-27
Family ATP-dependent DNA ligase DNA-binding domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256374868|ref|YP_003098528.1|
Sequence length 537
Comment ATP-dependent DNA ligase [Actinosynnema mirum DSM 43827]
Sequence
MLFSRVVEVSAEVGSTRSRLAKVSALAGLLRGVEDTGATGDTEAVVSFLVGVPRQGRIGA
GFRTARQLAAPPADEASLRVSDVDGALGEFAAESGRGSAARRAALLATLFAGATADEQDF
LKRLLTGELRQGALEGVMLDAVARAAGVPGEAVRRAFMLSGELPATAAAALRDGVDGLAR
FRLEVGRPVRPMLASPAESLEDALAGSGPVVVEHKLDGARIQVHRDGDEVRVFTRTLREI
TRTVPELVELARGLPCRSVVLDGETLALRDDGKPRPFQETMSRFGAQDERELLLSPFFFD
CLHLDGDDLLDRPLRERLAALRSAAGRHVVPGVADASAEAAAGVLRDALAGGHEGVVVKD
LDAPYAAGRRGGAWRKVKPVHTLDLVVLGVEWGSGRREGLLSNLHLGARDPDGGPPVMVG
KTFKGLTDELLAWQTRALLAIAEERGEWVVRVRPELVVEIELDGAQVSPRYPGGVALRFA
RVVRYRPDKTAAEADTLDAVRAMLPERAAPEGGGAPLDPREPATGAPRAQDTAGDHG
Download sequence
Identical sequences C6WKS7
gi|256374868|ref|YP_003098528.1| WP_012783344.1.52053 446462.Amir_0719

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]