SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256375514|ref|YP_003099174.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256375514|ref|YP_003099174.1|
Domain Number 1 Region: 23-302
Classification Level Classification E-value
Superfamily Transmembrane di-heme cytochromes 7.22e-62
Family Cytochrome b of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) 0.0000929
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256375514|ref|YP_003099174.1|
Sequence length 564
Comment cytochrome b/b6 domain-containing protein [Actinosynnema mirum DSM 43827]
Sequence
MSGITTPTKRQPAGARAAAGAAKWADDRFHMAGGIRKQLNKVFPTHWSFLLGEIALYSFI
ILLLSGTYLALFFDPSMQEVTYNGSFVNLQGIEMSRAFESTLNINFEVRGGLFVRQVHHW
AALLFMAAIVVHMFRIFFTGAFRRPREINWVIGILLFMLGAIEGFLGYSLPDDLLSGTGL
RVMAALLISFPVIGTWTNWLLFGGEFPGMDIIPRLYTLHILVVPAVILALIAVHLGLVWY
QKHTQFPGVGRKETNVVGVRIMPVFAAKGGGFFAVVVAVTALMGGVFQINPIWNIGPYNA
AQVSAGSQPDWYMGWTDGLVRLWPAWELYLGDYTVPAPFWPFILGLPLLTGIAAAYPWIE
RRMTKDYAHHNLLQRPRDVPVRTSLGMMAITYFMVMLLMGANDIIAFKFDISLNATTWMG
RIGLLLLPPLAYFVTYRLCIGLQKADREVLEHGVETGIIKRLPHGEFIEVHQPLGPVDDH
GHPVALEYQGAPVPKKMNKLGAAGHPVPGSFFTPDKPEETAALARARAAQGSGVGTLSAE
NKPADPSERGSANPKSVEGDRAGD
Download sequence
Identical sequences C6W9G5
gi|256375514|ref|YP_003099174.1| WP_015800218.1.52053 446462.Amir_1376

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]