SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256376480|ref|YP_003100140.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256376480|ref|YP_003100140.1|
Domain Number 1 Region: 1-386
Classification Level Classification E-value
Superfamily Phase 1 flagellin 3.92e-93
Family Phase 1 flagellin 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256376480|ref|YP_003100140.1|
Sequence length 386
Comment flagellin domain-containing protein [Actinosynnema mirum DSM 43827]
Sequence
MSLRINSNIAAMNAYRNLSVNDKQMAGSLEKLSSGLRINRAADDAAGLSISQGLTSQIGG
LKVAARNAQDGVNVVQTADGALNESAEILQRMRDLAVQASNGGSQDTNARAAAQTEFGQL
QKELDRIAKTTSFGGQKLLDTAGTAYNGTFQVGANNTADDQIQVNLDATVFGSSGGTKSS
YTVSGGTYDSATLDTKTITATQGATTATVTLATPADLDAVVSQLNADATFSGGFTASKDG
GELKIESKTNGTGAVTLTGTSGLTGAGTNGTAGATGFDSAGLGVGTTVKVDTTANAQSAI
DSIDSAIKGLSTARAQLGAYQNRFEHTINNINVQVENLSASKSNITDTDMAQEMVKFTRS
QILSQAGTAMLAQANQAPQNVLQLLR
Download sequence
Identical sequences C6WJR9
gi|256376480|ref|YP_003100140.1| WP_015801183.1.52053 446462.Amir_2354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]