SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256376484|ref|YP_003100144.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256376484|ref|YP_003100144.1|
Domain Number 1 Region: 4-292
Classification Level Classification E-value
Superfamily Phase 1 flagellin 2.62e-52
Family Phase 1 flagellin 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256376484|ref|YP_003100144.1|
Sequence length 292
Comment flagellar hook-associated protein 3 [Actinosynnema mirum DSM 43827]
Sequence
MNISRVTERSMSTGILSSLQRNQNKMDQLREAISSGKQLTKPSDGPTDTVSAMQLRTEIA
ERGAYSRSAVDGQARLGAAETALSSTSDLLLRARDLVLQGKSAQSQDSREAIAAEIDAIR
TSMIGLANTTYLDRPVFGGTTAGGQAFASDGSYLGDDGQVMRRIANGTQVRVDVPADTFG
TGSNQVFKVLESIAGNMRSNPAGLSADLDRLDSGIKTVNTAVTGIGTRYGQLSAADDAGQ
AQVVTLSARLSQIEDVDVAAAVVELQTQTVAYEASLAATARIVQPSLLDFLR
Download sequence
Identical sequences C6WJS3
WP_015801187.1.52053 gi|256376484|ref|YP_003100144.1| 446462.Amir_2358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]