SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256377802|ref|YP_003101462.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256377802|ref|YP_003101462.1|
Domain Number 1 Region: 4-161
Classification Level Classification E-value
Superfamily Prim-pol domain 3.79e-30
Family Bifunctional DNA primase/polymerase N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256377802|ref|YP_003101462.1|
Sequence length 271
Comment Bifunctional DNA primase/polymerase [Actinosynnema mirum DSM 43827]
Sequence
MSGVRVALAAVERGWPVIPLRPGGKAPVLRDWDRRATADPDRVRAWWARAPFNVGIACRG
AGLLVVDLDVPGGREVFEGLGSSPVTYRVGTPSGGEHRYFRAPPVRLGNSAGRLGPRVDT
RGVGGYVVAAGSAVRGVRYRVLCDEPVAPAPEWLVAALAPAPRSPVAPAVNPSSRRVRAY
RDAVVAGEVERVRGALPGTRAHVVFTAACRLGELVGAGWLGERQAEELLLDAASTHVGVD
GWTEREAARHVRNGVVAGSRRPRVIPEQRRG
Download sequence
Identical sequences C6WCZ7
WP_015802503.1.52053 446462.Amir_3733 gi|256377802|ref|YP_003101462.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]