SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256378283|ref|YP_003101943.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256378283|ref|YP_003101943.1|
Domain Number - Region: 92-160
Classification Level Classification E-value
Superfamily PA domain 0.00523
Family PA domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256378283|ref|YP_003101943.1|
Sequence length 175
Comment hypothetical protein Amir_4242 [Actinosynnema mirum DSM 43827]
Sequence
MEKKFGMCMKKSTWPIRAAIAALLLPATAVAAPTASAESATPDRITSSGLSARSPELSAS
ATSTVTNGPWSCTLTASNPNRWFGGSGGGEQGIGSVSCTGGVVMPAIYVAVGLYRNGSLI
ASDQLEKANSIVVNRVASASPHVSAAYETGALGAVLWPDNTITEIPQIYSIVVRT
Download sequence
Identical sequences C6WIK7
gi|256378283|ref|YP_003101943.1| 446462.Amir_4242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]