SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256379656|ref|YP_003103316.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256379656|ref|YP_003103316.1|
Domain Number 1 Region: 15-125
Classification Level Classification E-value
Superfamily S-adenosylmethionine decarboxylase 1.26e-33
Family Bacterial S-adenosylmethionine decarboxylase 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256379656|ref|YP_003103316.1|
Sequence length 137
Comment S-adenosylmethionine decarboxylase proenzyme [Actinosynnema mirum DSM 43827]
Sequence
MSELPCETEPVGLFAGQHVLAELEGVSPELLDDERFLRHALGEALTQADATVLEVVSKQF
DPQGVTVLALLSESHASIHTYPEVGKVFVDVFTCGTRAKPELAVRLLSEALGAEHARTDT
VRRGTGRVPALVGEEKS
Download sequence
Identical sequences C6WC82
446462.Amir_5655 gi|256379656|ref|YP_003103316.1| WP_015804355.1.52053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]