SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256380197|ref|YP_003103857.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256380197|ref|YP_003103857.1|
Domain Number 1 Region: 163-431,491-535
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.6e-80
Family Type II chitinase 0.00000946
Further Details:      
 
Domain Number 2 Region: 30-134
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.19e-28
Family Cellulose-binding domain family II 0.00021
Further Details:      
 
Domain Number 3 Region: 433-492
Classification Level Classification E-value
Superfamily Chitinase insertion domain 0.0000000000000657
Family Chitinase insertion domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256380197|ref|YP_003103857.1|
Sequence length 536
Comment glycoside hydrolase family protein [Actinosynnema mirum DSM 43827]
Sequence
MSKTRWHLTALFTAVAALGVGLLVVPSASGAGGVSATFTKGSDWGTGYEGKYTIKNGSTS
ALASWTVEFDLPANHRVTSLWDGSHTTSGQRTTVKGTWNGALPAGGTASFGFNVSYTGTY
TGPTNCKLNGASCDAGGTNPTTTTTTSTTTTTGGPTTTTSNPPQPGGAKNLGYFTDWGIY
ARKYYVKNIVTSGSAAKLTHINYAFGNVTNGQCVMGDGDAATEKAFTAAESVDGVADTWD
GSLRGNFNQLRKLKKAYPHIKVLWSFGGWTWSGGFGQAAQNPAAFAESCYNLVENSKWAD
VFDGIDIDWEYPNACGLSCDSSGFAAFKNLSQALRAKFGPNNLVTAAITADGTNGGKIDA
ADYAGAAQYLDWYNVMTYDYFGAFAPTGPTAPHSPLNGYAGIPTADFHSDAAIKKLKAKG
IPSSKLLLGIGFYGRGWAGVTQAAPGGSATGPAPGTYEQGIEDYKVLKTRCPATGTVGGT
AYAYCGNQWWSYDTPATIGGKMSYAKGQGLGGAFFWALDGDTTNGELITAISNGLK
Download sequence
Identical sequences C6WHR2
gi|256380197|ref|YP_003103857.1| WP_015804895.1.52053 446462.Amir_6206

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]