SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256380585|ref|YP_003104245.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256380585|ref|YP_003104245.1|
Domain Number 1 Region: 4-61
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 2.07e-21
Family Ribosomal protein S14 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256380585|ref|YP_003104245.1|
Sequence length 61
Comment 30S ribosomal protein S14 [Actinosynnema mirum DSM 43827]
Sequence
MAKKALINKAAGKPKFKVRAYTRCQRCGRPHSVFRKFGLCRICLREMAHRGELPGVSKSS
W
Download sequence
Identical sequences A0A290ZEN5 C6WM14
gi|256380585|ref|YP_003104245.1| WP_015805279.1.52053 446462.Amir_6601

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]