SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256380895|ref|YP_003104555.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256380895|ref|YP_003104555.1|
Domain Number - Region: 95-216
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.0628
Family Phase 1 flagellin 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256380895|ref|YP_003104555.1|
Sequence length 359
Comment hypothetical protein Amir_6914 [Actinosynnema mirum DSM 43827]
Sequence
MAVRDELARRLRRWRMTALPILQAAVAAGLSWFVATKVVGHPHPFFAPIAAVVCLGVSLG
QRPRRVAELVVGVSVGVGIGDVLISHIGSGTWQIAVAVVLAMSAAVLLDGGAVIALQSAN
SAVLVATLLPPSAGGGFDRMVDALVGGVVGLAVTALIPANPLTVADRQAKVVLGELAIAL
RGVAAAVAKSDAGAAADVLARLRDSQEAVDEYRSALKTGGEIATIAPIRWRRKNALRRYG
SIATPVDYALRNTRVLTRRALAALRDDEHVPDVLPSALERFADAVDVLRAELASNEDPVK
SRAAIRAAAGVMTADLAVGEGFSTQVVLAQARSVAVDLLQATGLTRVEAMESLPPLRKP
Download sequence
Identical sequences C6WR16
446462.Amir_6914 gi|256380895|ref|YP_003104555.1| WP_015805586.1.52053

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]