SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|256378324|ref|YP_003101984.1| from Actinosynnema mirum DSM 43827

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256378324|ref|YP_003101984.1|
Domain Number 1 Region: 331-350,413-638
Classification Level Classification E-value
Superfamily HAD-like 1.03e-50
Family Meta-cation ATPase, catalytic domain P 0.0006
Further Details:      
 
Domain Number 2 Region: 135-231
Classification Level Classification E-value
Superfamily Calcium ATPase, transduction domain A 2.09e-24
Family Calcium ATPase, transduction domain A 0.0042
Further Details:      
 
Domain Number 3 Region: 84-136,233-326
Classification Level Classification E-value
Superfamily Calcium ATPase, transmembrane domain M 0.00000000000968
Family Calcium ATPase, transmembrane domain M 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256378324|ref|YP_003101984.1|
Sequence length 654
Comment heavy metal translocating P-type ATPase [Actinosynnema mirum DSM 43827]
Sequence
MTTVAPERPTTRAPARRTRWTALPEARWAAVSLALFLTALAVQLADGPEPVRWALYLACC
AAGGWEPGLSGLRALRERTLDVDLLMVVAAIGAVAVGQALDGALLIVIFATSGALEALAT
ARTEDSVRGLLDLAPDTATRVGDGAEEVVRVADLEVGDVVLVRPGELVPADGVVVAGAGE
VDQATITGEPLPVDKAEGDEVFAGTLNGTGALRVRVGKRAADSVVARIAAAVEEASRTKA
RTQLFIEKVEQRYSIGMVVATLVIFTAPLPWGEPVREALLRAMTFMIVASPCALVLATMP
PLLAAIANAGRHGVLVKSAVVVERLADADRVAFDKTGTLTRGEPEVAGLRALPGAGLDED
ALLRLAASAEHPSEHPLGRAVVRAARERGLDVPQAREFTARPGRGVRARVGDRVVEIGSP
EALGGAGIGGAGIGGAGIGAVDGFLTQGHTAVLVLVDGEPAGVLAIADRVRPEAAAAVAA
LTAATGAGPVLLTGDNRRTADRLAERVGITDVRAGLLPEDKAEAVRALQAEGRRVVVVGD
GVNDAPALAVAHAGVAMGAAGADLTLRTADAVVVRDDLSTIPAAIALARRAKRVVVANLV
IAGSFIVVLVAWDLLGDLPLPLGVAGHEGSTVIVGLNGLRLLREAAWRKAKAEG
Download sequence
Identical sequences C6WIP8
WP_015803025.1.52053 gi|256378324|ref|YP_003101984.1| 446462.Amir_4284

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]