SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474934419|ref|YP_007688001.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474934419|ref|YP_007688001.1|
Domain Number 1 Region: 7-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000891
Family Ubiquitin-related 0.09
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474934419|ref|YP_007688001.1|
Sequence length 91
Comment hypothetical protein TALC_00846 [Thermoplasmatales archaeon BRNA1]
Sequence
MVFNIRITVKNLMTSPPSTIRMEVSSDTTVAEILWSAQDMWRFNLAAVCLKLGRWLLDPE
WTVKDMGFPVDGTVLELIPHPGFDGDIRRVI
Download sequence
Identical sequences M4YUE2
gi|474934419|ref|YP_007688001.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]