SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|474934049|ref|YP_007687631.1| from Thermoplasmatales archaeon BRNA1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|474934049|ref|YP_007687631.1|
Domain Number 1 Region: 188-442
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 2.62e-116
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.000000025
Further Details:      
 
Domain Number 2 Region: 2-186
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.1e-65
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|474934049|ref|YP_007687631.1|
Sequence length 443
Comment methyl-coenzyme M reductase, beta subunit [Thermoplasmatales archaeon BRNA1]
Sequence
MPKYKDVIDLYDDYGKRIAKGVPLEAISPLRNKAIQKIASLTKRTVVVSLAGIEKALKTG
AVGGNNWIAGKEIDAPIVADAEKLAKDIKAMVQVTEDDGTQVIVKDGGKSLTVIVPEART
DAGIEYTTGFTTVAAATTEAIIDRYKVPMYKANMVKAAVWGRYPQTINFVGSNIKSILEV
PQNNEGAGFALRNIMSNHVVALVQRNAMQGTALSAIFETCAAYEMGDAVGPFERQHLLSL
AYQGLNANNVVYSLVKKNGKTGTVGTVVESLMARAIEDGVIRVKETLPSGYKVYTTDDLP
LWNAYAAAGEVAAVMVNVGAARAAQGVPSTVLYYNDLLEHESGLPGTDYGRAEGVGVGMS
FFSHSIYGGGGPGLFHGNHVVTRHAKGTLIPAVTAGNCLDGGTQTFSAEATSGVFNTAFG
GMPEFNAPMQFVGAEAKKIKNKL
Download sequence
Identical sequences M4YU68
gi|474934049|ref|YP_007687631.1| WP_015491988.1.41762

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]