SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|153002365|ref|YP_001368046.1| from Shewanella baltica OS185

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|153002365|ref|YP_001368046.1|
Domain Number 1 Region: 3-322
Classification Level Classification E-value
Superfamily FMN-binding split barrel 1.45e-123
Family UbiD middle domain-like 0.000000000279
Further Details:      
 
Domain Number 2 Region: 323-487
Classification Level Classification E-value
Superfamily UbiD C-terminal domain-like 1.44e-68
Family UbiD C-terminal domain-like 0.0000000677
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|153002365|ref|YP_001368046.1|
Sequence length 493
Comment UbiD family decarboxylase [Shewanella baltica OS185]
Sequence
MSFKDLRSFIDHLEANGELKRISYPVDPHLEMTEIADRVLRAKGPALLFENPKDHHMPVL
VNLFGTPKRVAMALGKDDPLALREVGELLAFLKEPEPPRGFKDAIAKIPMFKQALNMPPK
TVRNPPCQQVIKTGDEVDLTQLPIQHCWPGDVAPLVTWGLTITKGPRKSRQNLGIYRQQL
LGKNKLIMRWLSHRGGALDFADFKQQFPGERYPVVVALGADPVTILGAVTPVPDSMSEYA
FAGLLRGERTEVCKALSCDLEVPATSEIILEGYIGPEELAEEGPYGDHTGYYNETDKFPV
FTVTHITHRKDAIYHSTYTGRPPDEPAMLGVALNEVFVPILRKQYPEIVDFYLPPEGCSY
RMAVISIRKQYPGHAKRVMMGAWSFLRQFMYTKFIVIVDEDVNCRDWQDVIWAITTRMDP
KRDTVMIENTPIDYLDFASPVAGLGSKMGLDATNKWEGETNREWGTPIVMDPKVKQKIDS
IWDELGIDDSPTL
Download sequence
Identical sequences A3CZT2 A6WT44
gi|126172715|ref|YP_001048864.1| gi|386339489|ref|YP_006035855.1| WP_011845665.1.8014 WP_011845665.1.85636 WP_011845665.1.86146 gi|153002365|ref|YP_001368046.1| 325240.Sbal_0465 402882.Shew185_3859

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]