SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|111220166|ref|YP_710960.1| from Frankia alni ACN14a

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|111220166|ref|YP_710960.1|
Domain Number 1 Region: 563-872
Classification Level Classification E-value
Superfamily Aldolase 1.28e-74
Family HMGL-like 0.00000127
Further Details:      
 
Domain Number 2 Region: 93-373
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 9.19e-67
Family BC ATP-binding domain-like 0.00000869
Further Details:      
 
Domain Number 3 Region: 343-460
Classification Level Classification E-value
Superfamily Rudiment single hybrid motif 2.51e-40
Family BC C-terminal domain-like 0.0000796
Further Details:      
 
Domain Number 4 Region: 7-121
Classification Level Classification E-value
Superfamily PreATP-grasp domain 3.38e-39
Family BC N-terminal domain-like 0.0000732
Further Details:      
 
Domain Number 5 Region: 869-1037
Classification Level Classification E-value
Superfamily post-HMGL domain-like 4.71e-38
Family Conserved carboxylase domain 0.0022
Further Details:      
 
Domain Number 6 Region: 1095-1170
Classification Level Classification E-value
Superfamily Single hybrid motif 4.32e-17
Family Biotinyl/lipoyl-carrier proteins and domains 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|111220166|ref|YP_710960.1|
Sequence length 1172
Comment pyruvate carboxylase [Frankia alni ACN14a]
Sequence
MMRTPSEEARVRKVLVANRSEIAVRVFRAAQELGLRTVAVYTPEDVSALHRTKASEAYEL
GGPGHPVRGYLDIDALLTVAKQAEADALHPGYGFLSESAVLAEACAAAGVTFVGPPPSVL
RLTGDKVAARNAAMAAGLPVLRASTPLPDGQGAAQAAEEVGFPLFVKASAGGGGRGLRRV
ERAADLADAVASASREAAAAFGDGTVFLEQAVDRPRHIEVQVFADSYGNIIHLYERDCSV
QRRHQKVVEIAPAPRLDEAIRASICADAVRFAQHVGYVNAGTVEFLLGADGQYTFMEMNP
RIQVEHTVTEEVTGVDLVAAQLRIADGESLADLNLGQDQIALRGTAIQCRVTTEDPADGF
RPDTGTISFYQSPGGPGVRLDGATYAGAEVSPYFDSLLVKLTARGSTLEKAARRARRALN
EFRVRGVRTNIDFLGRVLTDPDFLAGGVTTSFIDERPELLLPGRGTDQTSRTLARLAEST
VNGFRRPAHALVDPRIRLPELPLLPDGQGVAIGPGSPACLGTGTGGGSGQGLSGAGLTGV
AVPAGSRQLLTELGPAGWAARLRAQEALAVTDTTLRDAHQSLLATRLRSFDILAAAPSFA
ALTPNLLSLEAWGGATYDVALRFLAEDPWERLAALRSTAPNQCLQMLLRGRNAVGYTPYP
DDVVRAFVAEAAATGVDIFRIFDALNDMEQMRPAIEAVLETGTAIAEGTLCYTGDLSDPG
EQIYTLDYYLRLADQLVAAGVHVLAIKDMAGLLRPAAAATLVTALRERFDLPVHLHTHDT
AGGQLATLLAASAAGVDAVDAAAAPMSGGTSQVNMSALVAATDHTPRATGIALSALSSME
AYWEAVRDLYAPFEAGLRAPTGAVYRHEIPGGQLTNLRQQAIALGLGERWPAVQEAYAVA
NELLGKPIKVTPTSKVVGDLALFLVGGGVDVATLREHPERFDLPASVLGYLAGELGTPPA
GFAEPFRERALAGRHPAPPSADLDPADAAELAVPGARRRAALSRLLFPGPWKDYLAAADS
YGDSSLVPTEPYLYGLRPGVPVAVTLEPGVEIIIELETLSEPDDAAMRTLYLRVNGQPRP
VRVRDNSITATTASARRADPGDANQIGAGLPGIVTFTVAAGDTVTQGQKLAVVEAMKMEA
AVTSPVAGTVGELVRANGDSVEVGDLLLVVRP
Download sequence
Identical sequences Q0RSV0
gi|111220166|ref|YP_710960.1| 326424.FRAAL0680

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]